KEGG   Homo sapiens (human): 5578Help
Entry
5578              CDS       T01001                                 

Gene name
PRKCA, AAG6, PKC-alpha, PKCA, PKCI+/-, PKCalpha, PRKACA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05130  Pathogenic Escherichia coli infection
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
Network
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
Drug target
Aprinocarsen sodium: D02970
Midostaurin: D05029
Tigilanol tiglate: D11191
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5578 (PRKCA)
   04015 Rap1 signaling pathway
    5578 (PRKCA)
   04010 MAPK signaling pathway
    5578 (PRKCA)
   04012 ErbB signaling pathway
    5578 (PRKCA)
   04310 Wnt signaling pathway
    5578 (PRKCA)
   04370 VEGF signaling pathway
    5578 (PRKCA)
   04066 HIF-1 signaling pathway
    5578 (PRKCA)
   04020 Calcium signaling pathway
    5578 (PRKCA)
   04070 Phosphatidylinositol signaling system
    5578 (PRKCA)
   04072 Phospholipase D signaling pathway
    5578 (PRKCA)
   04071 Sphingolipid signaling pathway
    5578 (PRKCA)
   04151 PI3K-Akt signaling pathway
    5578 (PRKCA)
   04150 mTOR signaling pathway
    5578 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5578 (PRKCA)
   04540 Gap junction
    5578 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5578 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    5578 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    5578 (PRKCA)
   04670 Leukocyte transendothelial migration
    5578 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    5578 (PRKCA)
   04912 GnRH signaling pathway
    5578 (PRKCA)
   04921 Oxytocin signaling pathway
    5578 (PRKCA)
   04926 Relaxin signaling pathway
    5578 (PRKCA)
   04918 Thyroid hormone synthesis
    5578 (PRKCA)
   04919 Thyroid hormone signaling pathway
    5578 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    5578 (PRKCA)
   04916 Melanogenesis
    5578 (PRKCA)
   04925 Aldosterone synthesis and secretion
    5578 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5578 (PRKCA)
   04270 Vascular smooth muscle contraction
    5578 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    5578 (PRKCA)
   04971 Gastric acid secretion
    5578 (PRKCA)
   04972 Pancreatic secretion
    5578 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5578 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5578 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    5578 (PRKCA)
   04727 GABAergic synapse
    5578 (PRKCA)
   04725 Cholinergic synapse
    5578 (PRKCA)
   04728 Dopaminergic synapse
    5578 (PRKCA)
   04726 Serotonergic synapse
    5578 (PRKCA)
   04720 Long-term potentiation
    5578 (PRKCA)
   04730 Long-term depression
    5578 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    5578 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5578 (PRKCA)
  09158 Development
   04360 Axon guidance
    5578 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5578 (PRKCA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5578 (PRKCA)
   05231 Choline metabolism in cancer
    5578 (PRKCA)
   05206 MicroRNAs in cancer
    5578 (PRKCA)
   05205 Proteoglycans in cancer
    5578 (PRKCA)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    5578 (PRKCA)
   05214 Glioma
    5578 (PRKCA)
   05223 Non-small cell lung cancer
    5578 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    5578 (PRKCA)
   05032 Morphine addiction
    5578 (PRKCA)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5578 (PRKCA)
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    5578 (PRKCA)
   05130 Pathogenic Escherichia coli infection
    5578 (PRKCA)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5578 (PRKCA)
   05164 Influenza A
    5578 (PRKCA)
   05161 Hepatitis B
    5578 (PRKCA)
   05163 Human cytomegalovirus infection
    5578 (PRKCA)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    5578 (PRKCA)
   05143 African trypanosomiasis
    5578 (PRKCA)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5578 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5578 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5578 (PRKCA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5578 (PRKCA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5578 (PRKCA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    5578 (PRKCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Haspin_kinase APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 5578
NCBI-ProteinID: NP_002728
OMIM: 176960
HGNC: 9393
Ensembl: ENSG00000154229
Vega: OTTHUMG00000179533
Pharos: P17252(Tchem)
UniProt: P17252 Q7Z727
Structure
PDB: 

Position
17q24.2
AA seq 672 aa AA seqDB search
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaggaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagagcatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccacct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system