KEGG   Homo sapiens (human): 5578Help
Entry
5578              CDS       T01001                                 

Gene name
PRKCA, AAG6, PKC-alpha, PKCA, PRKACA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05110  Vibrio cholerae infection
hsa05130  Pathogenic Escherichia coli infection
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
Network
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
Drug target
Aprinocarsen sodium: D02970
Midostaurin: D05029
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5578 (PRKCA)
   04015 Rap1 signaling pathway
    5578 (PRKCA)
   04010 MAPK signaling pathway
    5578 (PRKCA)
   04012 ErbB signaling pathway
    5578 (PRKCA)
   04310 Wnt signaling pathway
    5578 (PRKCA)
   04370 VEGF signaling pathway
    5578 (PRKCA)
   04066 HIF-1 signaling pathway
    5578 (PRKCA)
   04020 Calcium signaling pathway
    5578 (PRKCA)
   04070 Phosphatidylinositol signaling system
    5578 (PRKCA)
   04072 Phospholipase D signaling pathway
    5578 (PRKCA)
   04071 Sphingolipid signaling pathway
    5578 (PRKCA)
   04151 PI3K-Akt signaling pathway
    5578 (PRKCA)
   04150 mTOR signaling pathway
    5578 (PRKCA)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5578 (PRKCA)
   04540 Gap junction
    5578 (PRKCA)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5578 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    5578 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    5578 (PRKCA)
   04670 Leukocyte transendothelial migration
    5578 (PRKCA)
  Endocrine system
   04911 Insulin secretion
    5578 (PRKCA)
   04912 GnRH signaling pathway
    5578 (PRKCA)
   04921 Oxytocin signaling pathway
    5578 (PRKCA)
   04926 Relaxin signaling pathway
    5578 (PRKCA)
   04918 Thyroid hormone synthesis
    5578 (PRKCA)
   04919 Thyroid hormone signaling pathway
    5578 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    5578 (PRKCA)
   04916 Melanogenesis
    5578 (PRKCA)
   04925 Aldosterone synthesis and secretion
    5578 (PRKCA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5578 (PRKCA)
   04270 Vascular smooth muscle contraction
    5578 (PRKCA)
  Digestive system
   04970 Salivary secretion
    5578 (PRKCA)
   04971 Gastric acid secretion
    5578 (PRKCA)
   04972 Pancreatic secretion
    5578 (PRKCA)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5578 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5578 (PRKCA)
  Nervous system
   04724 Glutamatergic synapse
    5578 (PRKCA)
   04727 GABAergic synapse
    5578 (PRKCA)
   04725 Cholinergic synapse
    5578 (PRKCA)
   04728 Dopaminergic synapse
    5578 (PRKCA)
   04726 Serotonergic synapse
    5578 (PRKCA)
   04720 Long-term potentiation
    5578 (PRKCA)
   04730 Long-term depression
    5578 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    5578 (PRKCA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5578 (PRKCA)
  Development
   04360 Axon guidance
    5578 (PRKCA)
  Environmental adaptation
   04713 Circadian entrainment
    5578 (PRKCA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5578 (PRKCA)
   05231 Choline metabolism in cancer
    5578 (PRKCA)
   05206 MicroRNAs in cancer
    5578 (PRKCA)
   05205 Proteoglycans in cancer
    5578 (PRKCA)
   05225 Hepatocellular carcinoma
    5578 (PRKCA)
   05214 Glioma
    5578 (PRKCA)
   05223 Non-small cell lung cancer
    5578 (PRKCA)
  Substance dependence
   05031 Amphetamine addiction
    5578 (PRKCA)
   05032 Morphine addiction
    5578 (PRKCA)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5578 (PRKCA)
  Infectious diseases
   05110 Vibrio cholerae infection
    5578 (PRKCA)
   05130 Pathogenic Escherichia coli infection
    5578 (PRKCA)
   05164 Influenza A
    5578 (PRKCA)
   05161 Hepatitis B
    5578 (PRKCA)
   05163 Human cytomegalovirus infection
    5578 (PRKCA)
   05146 Amoebiasis
    5578 (PRKCA)
   05143 African trypanosomiasis
    5578 (PRKCA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5578 (PRKCA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5578 (PRKCA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5578 (PRKCA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    5578 (PRKCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Haspin_kinase APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 5578
NCBI-ProteinID: NP_002728
OMIM: 176960
HGNC: 9393
Ensembl: ENSG00000154229
Vega: OTTHUMG00000179533
Pharos: P17252(Tchem)
UniProt: P17252 Q7Z727
Structure
PDB: 

Position
17q24.2
AA seq 672 aa AA seqDB search
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaggaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagagcatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccacct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

KEGG   Homo sapiens (human): 5579Help
Entry
5579              CDS       T01001                                 

Gene name
PRKCB, PKC-beta, PKCB, PRKCB1, PRKCB2
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05140  Leishmaniasis
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
Network
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
Drug target
Enzastaurin hydrochloride: D04014
Midostaurin: D05029
Safingol: D05784
Safingol hydrochloride: D05785
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5579 (PRKCB)
   04015 Rap1 signaling pathway
    5579 (PRKCB)
   04010 MAPK signaling pathway
    5579 (PRKCB)
   04012 ErbB signaling pathway
    5579 (PRKCB)
   04310 Wnt signaling pathway
    5579 (PRKCB)
   04370 VEGF signaling pathway
    5579 (PRKCB)
   04064 NF-kappa B signaling pathway
    5579 (PRKCB)
   04066 HIF-1 signaling pathway
    5579 (PRKCB)
   04020 Calcium signaling pathway
    5579 (PRKCB)
   04070 Phosphatidylinositol signaling system
    5579 (PRKCB)
   04071 Sphingolipid signaling pathway
    5579 (PRKCB)
   04150 mTOR signaling pathway
    5579 (PRKCB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5579 (PRKCB)
   04540 Gap junction
    5579 (PRKCB)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5579 (PRKCB)
   04662 B cell receptor signaling pathway
    5579 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    5579 (PRKCB)
   04670 Leukocyte transendothelial migration
    5579 (PRKCB)
   04062 Chemokine signaling pathway
    5579 (PRKCB)
  Endocrine system
   04911 Insulin secretion
    5579 (PRKCB)
   04912 GnRH signaling pathway
    5579 (PRKCB)
   04921 Oxytocin signaling pathway
    5579 (PRKCB)
   04918 Thyroid hormone synthesis
    5579 (PRKCB)
   04919 Thyroid hormone signaling pathway
    5579 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    5579 (PRKCB)
   04916 Melanogenesis
    5579 (PRKCB)
   04925 Aldosterone synthesis and secretion
    5579 (PRKCB)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5579 (PRKCB)
  Digestive system
   04970 Salivary secretion
    5579 (PRKCB)
   04971 Gastric acid secretion
    5579 (PRKCB)
   04972 Pancreatic secretion
    5579 (PRKCB)
   04973 Carbohydrate digestion and absorption
    5579 (PRKCB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5579 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5579 (PRKCB)
  Nervous system
   04724 Glutamatergic synapse
    5579 (PRKCB)
   04727 GABAergic synapse
    5579 (PRKCB)
   04725 Cholinergic synapse
    5579 (PRKCB)
   04728 Dopaminergic synapse
    5579 (PRKCB)
   04726 Serotonergic synapse
    5579 (PRKCB)
   04720 Long-term potentiation
    5579 (PRKCB)
   04730 Long-term depression
    5579 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    5579 (PRKCB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5579 (PRKCB)
  Environmental adaptation
   04713 Circadian entrainment
    5579 (PRKCB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5579 (PRKCB)
   05231 Choline metabolism in cancer
    5579 (PRKCB)
   05206 MicroRNAs in cancer
    5579 (PRKCB)
   05205 Proteoglycans in cancer
    5579 (PRKCB)
   05225 Hepatocellular carcinoma
    5579 (PRKCB)
   05214 Glioma
    5579 (PRKCB)
   05223 Non-small cell lung cancer
    5579 (PRKCB)
  Substance dependence
   05031 Amphetamine addiction
    5579 (PRKCB)
   05032 Morphine addiction
    5579 (PRKCB)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5579 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5579 (PRKCB)
  Infectious diseases
   05164 Influenza A
    5579 (PRKCB)
   05161 Hepatitis B
    5579 (PRKCB)
   05163 Human cytomegalovirus infection
    5579 (PRKCB)
   05146 Amoebiasis
    5579 (PRKCB)
   05140 Leishmaniasis
    5579 (PRKCB)
   05143 African trypanosomiasis
    5579 (PRKCB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5579 (PRKCB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5579 (PRKCB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5579 (PRKCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Kinase-like Haspin_kinase CEP76-C2 APH
Motif
Other DBs
NCBI-GeneID: 5579
NCBI-ProteinID: NP_997700
OMIM: 176970
HGNC: 9395
Ensembl: ENSG00000166501
Vega: OTTHUMG00000131615
Pharos: P05771(Tchem)
UniProt: P05771
Structure
PDB: 

Position
16p12.2-p12.1
AA seq 671 aa AA seqDB search
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcatgaggtcaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctccgatgacccccgcagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaatgtgcac
aagcgctgcgtgatgaatgttcccagcctgtgtggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagggacgtcctcattgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcctgtcagatccctacgtaaaactgaaactg
attcccgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cctgagtggaatgagacatttagatttcagctgaaagaatcggacaaagacagaagactg
tcagtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaacttcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgaggccaatgaagaa
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtcccggaagaaaag
acgaccaacactgtctccaaatttgacaacaatggcaacagagaccggatgaaactgacc
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggacgttgtgatccaa
gatgatgacgtggagtgcactatggtggagaagcgggtgttggccctgcctgggaagccg
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaatgggggcgacctcatgtatcacatccagcaagtcggccggttcaaggag
ccccatgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattctgagggacacatc
aagattgccgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccaatccatcatggaacacaacgtagcctat
cccaagtctatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggttgtggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccttataagccaaaa
gctagagacaagagagacacctccaacttcgacaaagagttcaccagacagcctgtggaa
ctgacccccactgataaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcttatactaacccagagtttgtcattaatgtgtag

KEGG   Homo sapiens (human): 5582Help
Entry
5582              CDS       T01001                                 

Gene name
PRKCG, PKC-gamma, PKCC, PKCG, SCA14
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
Network
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
Disease
H00063  Spinocerebellar ataxia (SCA)
Drug target
Midostaurin: D05029
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5582 (PRKCG)
   04015 Rap1 signaling pathway
    5582 (PRKCG)
   04010 MAPK signaling pathway
    5582 (PRKCG)
   04012 ErbB signaling pathway
    5582 (PRKCG)
   04310 Wnt signaling pathway
    5582 (PRKCG)
   04370 VEGF signaling pathway
    5582 (PRKCG)
   04066 HIF-1 signaling pathway
    5582 (PRKCG)
   04020 Calcium signaling pathway
    5582 (PRKCG)
   04070 Phosphatidylinositol signaling system
    5582 (PRKCG)
   04071 Sphingolipid signaling pathway
    5582 (PRKCG)
   04150 mTOR signaling pathway
    5582 (PRKCG)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5582 (PRKCG)
   04540 Gap junction
    5582 (PRKCG)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5582 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    5582 (PRKCG)
   04670 Leukocyte transendothelial migration
    5582 (PRKCG)
  Endocrine system
   04911 Insulin secretion
    5582 (PRKCG)
   04921 Oxytocin signaling pathway
    5582 (PRKCG)
   04918 Thyroid hormone synthesis
    5582 (PRKCG)
   04919 Thyroid hormone signaling pathway
    5582 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    5582 (PRKCG)
   04916 Melanogenesis
    5582 (PRKCG)
   04925 Aldosterone synthesis and secretion
    5582 (PRKCG)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5582 (PRKCG)
  Digestive system
   04970 Salivary secretion
    5582 (PRKCG)
   04971 Gastric acid secretion
    5582 (PRKCG)
   04972 Pancreatic secretion
    5582 (PRKCG)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5582 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5582 (PRKCG)
  Nervous system
   04724 Glutamatergic synapse
    5582 (PRKCG)
   04727 GABAergic synapse
    5582 (PRKCG)
   04725 Cholinergic synapse
    5582 (PRKCG)
   04728 Dopaminergic synapse
    5582 (PRKCG)
   04726 Serotonergic synapse
    5582 (PRKCG)
   04720 Long-term potentiation
    5582 (PRKCG)
   04730 Long-term depression
    5582 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    5582 (PRKCG)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5582 (PRKCG)
  Environmental adaptation
   04713 Circadian entrainment
    5582 (PRKCG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5582 (PRKCG)
   05231 Choline metabolism in cancer
    5582 (PRKCG)
   05206 MicroRNAs in cancer
    5582 (PRKCG)
   05205 Proteoglycans in cancer
    5582 (PRKCG)
   05225 Hepatocellular carcinoma
    5582 (PRKCG)
   05214 Glioma
    5582 (PRKCG)
   05223 Non-small cell lung cancer
    5582 (PRKCG)
  Substance dependence
   05031 Amphetamine addiction
    5582 (PRKCG)
   05032 Morphine addiction
    5582 (PRKCG)
  Infectious diseases
   05161 Hepatitis B
    5582 (PRKCG)
   05163 Human cytomegalovirus infection
    5582 (PRKCG)
   05146 Amoebiasis
    5582 (PRKCG)
   05143 African trypanosomiasis
    5582 (PRKCG)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5582 (PRKCG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5582 (PRKCG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5582 (PRKCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase C1_1 Pkinase_Tyr C2 Pkinase_C Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5582
NCBI-ProteinID: NP_002730
OMIM: 176980
HGNC: 9402
Ensembl: ENSG00000126583
Vega: OTTHUMG00000064846
Pharos: P05129(Tchem)
UniProt: P05129
Structure
PDB: 

Position
19q13.42
AA seq 697 aa AA seqDB search
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctgggccccggcgtaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggccctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaaa
cacaagttccgcctgcatagctacagcagccccaccttctgcgaccactgtggctccctc
ctctacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggagatccgggctcccacagcagatgagatccacgtaactgttggcgaggcc
cgtaacctaattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacggtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaacctgaagccaggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggggccatgtcc
tttggcgtctcggagctgctcaaggcgcccgtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcgagtccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctctgatgagctctacgccatcaag
atcttgaaaaaggacgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgtgtgctggcgctggggggccggggtcctggcggccggccccacttcctcacccagctc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcggcagaaatcgctatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgactttggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgag
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system