KEGG   Homo sapiens (human): 55783
Entry
55783             CDS       T01001                                 
Symbol
CMTR2, AFT, FTSJD1, HMTr2, MTr2
Name
(RefSeq) cap methyltransferase 2
  KO
K14590  cap2 methyltransferase [EC:2.1.1.296]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55783 (CMTR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.296  methyltransferase cap2
     55783 (CMTR2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     55783 (CMTR2)
SSDB
Motif
Pfam: FtsJ IRF
Other DBs
NCBI-GeneID: 55783
NCBI-ProteinID: NP_001093112
OMIM: 616190
HGNC: 25635
Ensembl: ENSG00000180917
Pharos: Q8IYT2(Tbio)
UniProt: Q8IYT2
Position
16:complement(71281392..71289722)
AA seq 770 aa
MSKCRKTPVQQLASPASFSPDILADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTEL
NAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHE
ILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEA
NDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFISSMATVHLVTADGSFDC
QGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCFDQVHV
FKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRH
EECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLV
KKSSIGCSTNTKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS
ILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPK
QQYSCSCHVFSEELIFSELCSLTECLQDEQVVVPSNQIKCLLVGFSTLRNIKMHIPLEVR
LLESAELTTFSCSLLHDGDPTYQRLFLDCLLHSLRELHTGDVMILPVLSCFTRFMAGLIF
VLHSCFRFITFVCPTSSDPLRTCAVLLCVGYQDLPNPVFRYLQSVNELLSTLLNSDSPQQ
VLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgagtaagtgcagaaagacaccagttcagcagctagcaagtcccgcgtcattcagccca
gatattcttgctgacatttttgaactctttgccaagaacttttcttatggcaagccactt
aataatgagtggcagttaccagatcccagtgagattttcacctgtgaccacactgaactt
aatgcatttcttgatttgaagaactccctaaatgaagtaaaaaacctactgagtgataag
aaactggatgagtggcatgagcacactgctttcactaataaagcggggaaaatcatttct
catgttagaaaatctgtgaatgctgaactttgtactcaagcatggtgtaagttccatgag
attttgtgcagctttccacttattccacaggaagcttttcagaatggaaaactgaattct
ctacacctttgtgaagctccaggagcttttatagctagtctcaaccactacttaaaatcc
catcggtttccttgtcattggagttgggtagcgaatactctgaatccataccatgaagca
aatgacgacctcatgatgattatggatgaccggcttattgcaaataccttgcactggtgg
tactttggtccagataacactggtgatatcatgaccctgaaattcttgactggacttcag
aatttcataagcagcatggctactgttcacttggtcactgcagatgggagttttgattgc
caaggaaacccaggtgaacaagaagctttagtttcttctttgcattactgtgaagttgtc
actgctctgaccactcttggaaacggtggctcttttgttctaaagatgtttactatgttt
gaacattgttccataaacttgatgtacctgctaaactgttgttttgaccaagtccatgtt
ttcaaacctgctactagcaaggcaggaaactccgaagtctatgtggtttgcctccactat
aaggggagagaggccatccatcctctgttatctaagatgaccttgaattttgggactgaa
atgaaaaggaaagccctttttccccatcatgtgattcctgattcttttcttaagagacat
gaagaatgttgtgtgttctttcataaatatcagctagagactatttctgaaaacattcgt
ctatttgagtgcatgggaaaggcggaacaagaaaagctgaataatttaagggattgtgct
atacaatattttatgcaaaaatttcaactgaaacatctttccagaaataattggctagta
aaaaaatctagtattggttgtagtacaaatacaaaatggtttgggcagaggaacaaatat
tttaaaacttataatgaaaggaagatgctagaagccctttcatggaaagataaagtagcc
aaaggatactttaatagttgggctgaagaacatggtgtatatcatcctgggcagagttct
attttagaaggaacagcttccaatcttgagtgtcacttatggcatattttggagggaaag
aaactgccaaaggtaaaatgttctcctttttgcaatggtgaaattttaaaaactcttaat
gaagcaattgaaaagtcattaggaggagcttttaatttggattccaagtttaggccaaaa
cagcagtattcttgttcttgtcatgttttttctgaagaactgatattttccgagttgtgt
agccttactgagtgccttcaggatgagcaggttgtagtacccagcaatcaaataaagtgc
ctgctggtgggcttttcgactctccgtaatatcaaaatgcatataccgttggaagttcga
ctcctagaatcagctgaactcacaacttttagctgttcattgcttcatgatggagatcca
acttaccagcgtttatttttggactgccttctacattcattgcgggagcttcatacagga
gatgttatgattttgcctgtactttcttgcttcacaagatttatggctggtttgatcttt
gtactccacagttgttttagattcatcacttttgtttgtcccacatcctctgatcccctg
aggacctgcgcagtcctgctatgtgttggttatcaggaccttccaaatccagttttccga
tatttgcagagtgtgaatgaattgttgagcactttgctcaactctgactcaccccagcag
gttttacagtttgtgccaatggaggtactccttaagggggccctgcttgattttttgtgg
gatttgaatgctgccattgctaaaaggcatttgcatttcattattcaaagagagagagaa
gaaattatcaacagccttcagttacaaaactga

DBGET integrated database retrieval system