KEGG   Homo sapiens (human): 55790Help
Entry
55790             CDS       T01001                                 

Gene name
CSGALNACT1, CSGalNAcT-1, ChGn, ChGn-1, beta4GalNAcT
Definition
(RefSeq) chondroitin sulfate N-acetylgalactosaminyltransferase 1
  KO
K00746  chondroitin sulfate N-acetylgalactosaminyltransferase 1/2 [EC:2.4.1.174 2.4.1.175]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    55790 (CSGALNACT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55790 (CSGALNACT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.174  glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase
     55790 (CSGALNACT1)
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     55790 (CSGALNACT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   55790 (CSGALNACT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHGN Glyco_transf_7C DUF4618
Motif
Other DBs
NCBI-GeneID: 55790
NCBI-ProteinID: NP_001123990
OMIM: 616615
HGNC: 24290
Ensembl: ENSG00000147408
Vega: OTTHUMG00000130827
Pharos: Q8TDX6(Tbio)
UniProt: Q8TDX6
Position
8p21.3
AA seq 532 aa AA seqDB search
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAV
LQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADL
LAFLHSQVDKAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDEL
VEAIESALETLNSPAENSPNHRPYTASDFIEGIYRTERDKGTLYELTFKGDHKHEFKRLI
LFRPFGPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFMQNFREMCIEQDGRVHLTVVY
FGKEEINEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLLFFCDVD
IYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAVPPLEQQLVIKKETGFWRD
FGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKR
CMDELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggttcgccgggggctgcttgcgtggatttcccgggtggtggttttgctggtg
ctcctctgctgtgctatctctgtcctgtacatgttggcctgcaccccaaaaggtgacgag
gagcagctggcactgcccagggccaacagccccacggggaaggaggggtaccaggccgtc
cttcaggagtgggaggagcagcaccgcaactacgtgagcagcctgaagcggcagatcgca
cagctcaaggaggagctgcaggagaggagtgagcagctcaggaatgggcagtaccaagcc
agcgatgctgctggcctgggtctggacaggagccccccagagaaaacccaggccgacctc
ctggccttcctgcactcgcaggtggacaaggcagaggtgaatgctggcgtcaagctggcc
acagagtatgcagcagtgcctttcgatagctttactctacagaaggtgtaccagctggag
actggccttacccgccaccccgaggagaagcctgtgaggaaggacaagcgggatgagttg
gtggaagccattgaatcagccttggagaccctgaacagtcctgcagagaacagccccaat
caccgtccttacacggcctctgatttcatagaagggatctaccgaacagaaagggacaaa
gggacattgtatgagctcaccttcaaaggggaccacaaacacgaattcaaacggctcatc
ttatttcgaccattcggccccatcatgaaagtgaaaaatgaaaagctcaacatggccaac
acgcttatcaatgttatcgtgcctctagcaaaaagggtggacaagttccggcagttcatg
cagaatttcagggagatgtgcattgagcaggatgggagagtccatctcactgttgtttac
tttgggaaagaagaaataaatgaagtcaaaggaatacttgaaaacacttccaaagctgcc
aacttcaggaactttaccttcatccagctgaatggagaattttctcggggaaagggactt
gatgttggagcccgcttctggaagggaagcaacgtccttctctttttctgtgatgtggac
atctacttcacatctgaattcctcaatacgtgtaggctgaatacacagccagggaagaag
gtattttatccagttcttttcagtcagtacaatcctggcataatatacggccaccatgat
gcagtccctcccttggaacagcagctggtcataaagaaggaaactggattttggagagac
tttggatttgggatgacgtgtcagtatcggtcagacttcatcaatataggtgggtttgat
ctggacatcaaaggctggggcggagaggatgtgcacctttatcgcaagtatctccacagc
aacctcatagtggtacggacgcctgtgcgaggactcttccacctctggcatgagaagcgc
tgcatggacgagctgacccccgagcagtacaagatgtgcatgcagtccaaggccatgaac
gaggcatcccacggccagctgggcatgctggtgttcaggcacgagatagaggctcacctt
cgcaaacagaaacagaagacaagtagcaaaaaaacatga

DBGET integrated database retrieval system