KEGG   Homo sapiens (human): 5580Help
Entry
5580              CDS       T01001                                 

Gene name
PRKCD, ALPS3, CVID9, MAY1, PKCD, nPKC-delta
Definition
(RefSeq) protein kinase C delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04140  Autophagy - animal
hsa04270  Vascular smooth muscle contraction
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
Disease
H00108  Autoimmune lymphoproliferative syndromes
Drug target
Delcasertib (DG02094): D10456 D10457
Safingol: D05784
Safingol hydrochloride: D05785
Sotrastaurin (DG01406): D09671 D09718
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5580 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    5580 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    5580 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    5580 (PRKCD)
   04062 Chemokine signaling pathway
    5580 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5580 (PRKCD)
   04915 Estrogen signaling pathway
    5580 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5580 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5580 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5580 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5580 (PRKCD)
   04931 Insulin resistance
    5580 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5580 (PRKCD)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5580 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5580 (PRKCD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5580 (PRKCD)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5580 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 Kinase-like zf-RING-like Zf_RING Haspin_kinase zf-RING_9 PHD Pkinase_fungal DZR APH FYVE_2 DUF2318
Motif
Other DBs
NCBI-GeneID: 5580
NCBI-ProteinID: NP_001303256
OMIM: 176977
HGNC: 9399
Ensembl: ENSG00000163932
Vega: OTTHUMG00000133659
Pharos: Q05655(Tclin)
UniProt: Q05655 B4DFV1 A0A024R328
Structure
PDB: 

Position
3p21.1
AA seq 676 aa AA seqDB search
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgttcctgcgcatcgccttcaactcctatgagctgggctccctgcaggccgag
gacgaggcgaaccagcccttctgtgccgtgaagatgaaggaggcgctcagcacagagcgt
gggaaaacactggtgcagaagaagccgaccatgtatcctgagtggaagtcgacgttcgat
gcccacatctatgaggggcgcgtcatccagattgtgctaatgcgggcagcagaggagcca
gtgtctgaggtgaccgtgggtgtgtcggtgctggccgagcgctgcaagaagaacaatggc
aaggctgagttctggctggacctgcagcctcaggccaaggtgttgatgtctgttcagtat
ttcctggaggacgtggattgcaaacagtctatgcgcagtgaggacgaggccaagttccca
acgatgaaccgccgcggagccatcaaacaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttgggcaacccaccttctgttctgtgtgcaaagactttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgtaacgctgccatccacaagaaatgc
atcgacaagatcatcggcagatgcactggcaccgcggccaacagccgggacactatattc
cagaaagaacgcttcaacatcgacatgccgcaccgcttcaaggttcacaactacatgagc
cccaccttctgtgaccactgcggcagcctgctctggggactggtgaagcagggattaaag
tgtgaagactgcggcatgaatgtgcaccataaatgccgggagaaggtggccaacctctgc
ggcatcaaccagaagcttttggctgaggccttgaaccaagtcacccagagagcctcccgg
agatcagactcagcctcctcagagcctgttgggatatatcagggtttcgagaagaagacc
ggagttgctggggaggacatgcaagacaacagtgggacctacggcaagatctgggagggc
agcagcaagtgcaacatcaacaacttcatcttccacaaggtcctgggcaaaggcagcttc
gggaaggtgctgcttggagagctgaagggcagaggagagtactttgccatcaaggccctc
aagaaggatgtggtcctgatcgacgacgacgtggagtgcaccatggttgagaagcgggtg
ctgacacttgccgcagagaatccctttctcacccacctcatctgcaccttccagaccaag
gaccacctgttctttgtgatggagttcctcaacgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgtgccacgttttatgccgctgagataatgtgtgga
ctgcagtttctacacagcaagggcatcatttacagggacctcaaactggacaatgtgctg
ctggaccgggatggccacatcaagattgccgactttgggatgtgcaaagagaacatattc
ggggagagccgggccagcaccttctgcggcacccctgactatatcgcccctgagatccta
cagggcctgaagtacacattctctgtggactggtggtctttcggggtccttctgtacgag
atgctcattggccagtcccccttccatggtgatgatgaggatgaactcttcgagtccatc
cgtgtggacacgccacattatccccgctggatcaccaaggagtccaaggacatcctggag
aagctctttgaaagggaaccaaccaagaggctgggagtgaccggaaacatcaaaatccac
cccttcttcaagaccataaactggactctgctggaaaagcggaggttggagccacctttc
aggcccaaagtgaagtcacccagagactacagtaactttgaccaggagttcctgaacgag
aaggcgcgcctctcctacagcgacaagaacctcatcgactccatggaccagtctgcattc
gctggcttctcctttgtgaaccccaaattcgagcacctcctggaagattga

KEGG   Homo sapiens (human): 5581Help
Entry
5581              CDS       T01001                                 

Gene name
PRKCE, PKCE, nPKC-epsilon
Definition
(RefSeq) protein kinase C epsilon
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04925  Aldosterone synthesis and secretion
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
hsa05206  MicroRNAs in cancer
Drug target
Safingol: D05784
Safingol hydrochloride: D05785
Sotrastaurin (DG01406): D09671 D09718
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5581 (PRKCE)
   04071 Sphingolipid signaling pathway
    5581 (PRKCE)
   04022 cGMP-PKG signaling pathway
    5581 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5581 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    5581 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    5581 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5581 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5581 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    5581 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5581 (PRKCE)
   04931 Insulin resistance
    5581 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5581 (PRKCE)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5581 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5581 (PRKCE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5581 (PRKCE)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5581 (PRKCE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 5581
NCBI-ProteinID: NP_005391
OMIM: 176975
HGNC: 9401
Ensembl: ENSG00000171132
Vega: OTTHUMG00000128817
Pharos: Q02156(Tchem)
UniProt: Q02156 L7RTI5
Structure
PDB: 

Position
2p21
AA seq 737 aa AA seqDB search
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccgcagactttccttctcgacccc
tacattgccctcaatgtggacgactcgcgcatcggccaaacggccaccaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgatgtgtgcaacggacgcaagatcgag
ctggctgtctttcacgatgcccccataggctacgacgacttcgtggccaactgcaccatc
cagtttgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggaagagtgtatgtgatcatcgatctctcagggtcgtcgggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggaacgcatgcggccgaggaagcggcagggggccgtc
aggcgcagggtccatcaggtcaacggccacaagttcatggccacctatcttcggcagccc
acctactgctcccattgcagagacttcatctggggtgtcataggaaagcagggataccag
tgtcaagtctgcacctgcgtggtccacaagcggtgccacgagctcataatcacaaagtgt
gctgggttaaagaagcaggagacccccgaccaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccctaccttctgcgatcactgtggg
tccctgctctggggactcttgcggcagggtttgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgtgagaccaacgtggctcccaactgtggagtggatgccagaggaatcgcc
aaagtactggccgacctgggcgttaccccagacaaaatcaccaacagcggccagagaagg
aaaaagctcattgctggtgccgagtccccgcagcctgcttctggaagctcaccatctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaaataaaagaacttgag
aacaacattcggaaagccttgtcatttgacaaccgaggagaggagcaccgggcagcatcg
tctcctgatggccagctgatgagccccggtgagaatggcgaagtccggcaaggccaggcc
aagcgcctgggcctggatgagttcaacttcatcaaggtgttgggcaaaggcagctttggc
aaggtcatgttggcagaactcaagggcaaagatgaagtatatgctgtgaaggtcttaaag
aaggacgtcatccttcaggatgatgacgtggactgcacaatgacagagaagaggattttg
gctctggcacggaaacacccgtaccttacccaactctactgctgcttccagaccaaggac
cgcctctttttcgtcatggaatatgtaaatggtggagacctcatgtttcagattcagcgc
tcccgaaaattcgacgagcctcgttcacggttctatgctgcagaggtcacatcggccctc
atgttcctccaccagcatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggctgacttcgggatgtgcaaggaagggattctgaat
ggtgtgacgaccaccacgttctgtgggactcctgactacatagctcctgagatcctgcag
gagttggagtatggcccctccgtggactggtgggccctgggggtgctgatgtacgagatg
atggctggacagcctccctttgaggccgacaatgaggacgacctatttgagtccatcctc
catgacgacgtgctgtacccagtctggctcagcaaggaggctgtcagcatcttgaaagct
ttcatgacgaagaatccccacaagcgcctgggctgtgtggcatcgcagaatggcgaggac
gccatcaagcagcacccattcttcaaagagattgactgggtgctcctggagcagaagaag
atcaagccacccttcaaaccacgcattaaaaccaaaagagacgtcaataattttgaccaa
gactttacccgggaagagccggtactcacccttgtggacgaagcaattgtaaagcagatc
aaccaggaggaattcaaaggtttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system