KEGG   Homo sapiens (human): 55808Help
Entry
55808             CDS       T01001                                 

Gene name
ST6GALNAC1, HSY11339, SIAT7A, ST6GalNAcI, STYI
Definition
(RefSeq) ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
  KO
K03479  alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7A) [EC:2.4.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    55808 (ST6GALNAC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55808 (ST6GALNAC1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.3  alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase
     55808 (ST6GALNAC1)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   55808 (ST6GALNAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 55808
NCBI-ProteinID: NP_060884
OMIM: 610138
HGNC: 23614
Ensembl: ENSG00000070526
Vega: OTTHUMG00000180369
Pharos: Q9NSC7(Tbio)
UniProt: Q9NSC7
Position
17q25.1
AA seq 600 aa AA seqDB search
MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLA
KPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQ
RAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTV
SEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPF
QSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPN
LTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSL
RCITCAVVGNGGILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQ
SLLILGNRGFKNVPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFR
EALHMDRYLLLHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYG
FITEGHERFSDHYYDTSWKRLIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcctgcctgtggagatgcaggcacctgagccaaggcgtccagtggtccttgctt
ctggctgtcctggtcttctttctcttcgccttgccctcttttattaaggagcctcaaaca
aagccttccaggcatcaacgcacagagaacattaaagaaaggtctctacagtccctggca
aagcctaagtcccaggcacccacaagggcaaggaggacaaccatctatgcagagccagtg
ccagagaacaatgccctcaacacacaaacccagcccaaggcccacaccaccggagacaga
ggaaaggaggccaaccaggcaccgccggaggagcaggacaaggtgccccacacagcacag
agggcagcatggaagagcccagaaaaagagaaaaccatggtgaacacactgtcacccaga
gggcaagatgcagggatggcctctggcaggacagaggcacaatcatggaagagccaggac
acaaagacgacccaaggaaatgggggccagaccaggaagctgacggcctccaggacggtg
tcagagaagcaccagggcaaagcggcaaccacagccaagacgctcattcccaaaagtcag
cacagaatgctggctcccacaggagcagtgtcaacaaggacgagacagaaaggagtgacc
acagcagtcatcccacctaaggagaagaaacctcaggccaccccaccccctgcccctttc
cagagccccacgacgcagagaaaccaaagactgaaggccgccaacttcaaatctgagcct
cggtgggattttgaggaaaaatacagcttcgaaataggaggccttcagacgacttgccct
gactctgtgaagatcaaagcctccaagtcgctgtggctccagaaactctttctgcccaac
ctcactctcttcctggactccagacacttcaaccagagtgagtgggaccgcctggaacac
tttgcaccaccctttggcttcatggagctcaactactccttggtgcagaaggtcgtgaca
cgcttccctccagtgccccagcagcagctgctcctggccagcctccccgctgggagcctc
cggtgcatcacctgtgccgtggtgggcaacgggggcatcctgaacaactcccacatgggc
caggagatagacagtcacgactacgtgttccgattgagcggagctctcattaaaggctac
gaacaggatgtggggactcggacatccttctacggctttaccgccttctccctgacccag
tcactccttatattgggcaatcggggtttcaagaacgtgcctcttgggaaggacgtccgc
tacttgcacttcctggaaggcacccgggactatgagtggctggaagcactgcttatgaat
cagacggtgatgtcaaaaaaccttttctggttcaggcacagaccccaggaagcttttcgg
gaagccctgcacatggacaggtacctgttgctgcacccagactttctccgatacatgaag
aacaggtttctgaggtctaagaccctggatggtgcccactggaggatataccgccccacc
actggggccctcctgctgctcactgcccttcagctctgtgaccaggtgagtgcttatggc
ttcatcactgagggccatgagcgcttttctgatcactactatgatacatcatggaagcgg
ctgatcttttacataaaccatgacttcaagctggagagagaagtctggaagcggctacac
gatgaagggataatccggctgtaccagcgtcctggtcccggaactgccaaagccaagaac
tga

DBGET integrated database retrieval system