KEGG   Homo sapiens (human): 5581Help
Entry
5581              CDS       T01001                                 

Gene name
PRKCE, PKCE, nPKC-epsilon
Definition
(RefSeq) protein kinase C epsilon
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04925  Aldosterone synthesis and secretion
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
hsa05206  MicroRNAs in cancer
Drug target
Safingol: D05784
Safingol hydrochloride: D05785
Sotrastaurin (DG01406): D09671 D09718
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5581 (PRKCE)
   04071 Sphingolipid signaling pathway
    5581 (PRKCE)
   04022 cGMP-PKG signaling pathway
    5581 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5581 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    5581 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    5581 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5581 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5581 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    5581 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5581 (PRKCE)
   04931 Insulin resistance
    5581 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5581 (PRKCE)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5581 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5581 (PRKCE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5581 (PRKCE)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5581 (PRKCE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 5581
NCBI-ProteinID: NP_005391
OMIM: 176975
HGNC: 9401
Ensembl: ENSG00000171132
Vega: OTTHUMG00000128817
Pharos: Q02156(Tchem)
UniProt: Q02156 L7RTI5
Structure
PDB: 

Position
2p21
AA seq 737 aa AA seqDB search
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccgcagactttccttctcgacccc
tacattgccctcaatgtggacgactcgcgcatcggccaaacggccaccaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgatgtgtgcaacggacgcaagatcgag
ctggctgtctttcacgatgcccccataggctacgacgacttcgtggccaactgcaccatc
cagtttgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggaagagtgtatgtgatcatcgatctctcagggtcgtcgggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggaacgcatgcggccgaggaagcggcagggggccgtc
aggcgcagggtccatcaggtcaacggccacaagttcatggccacctatcttcggcagccc
acctactgctcccattgcagagacttcatctggggtgtcataggaaagcagggataccag
tgtcaagtctgcacctgcgtggtccacaagcggtgccacgagctcataatcacaaagtgt
gctgggttaaagaagcaggagacccccgaccaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccctaccttctgcgatcactgtggg
tccctgctctggggactcttgcggcagggtttgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgtgagaccaacgtggctcccaactgtggagtggatgccagaggaatcgcc
aaagtactggccgacctgggcgttaccccagacaaaatcaccaacagcggccagagaagg
aaaaagctcattgctggtgccgagtccccgcagcctgcttctggaagctcaccatctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaaataaaagaacttgag
aacaacattcggaaagccttgtcatttgacaaccgaggagaggagcaccgggcagcatcg
tctcctgatggccagctgatgagccccggtgagaatggcgaagtccggcaaggccaggcc
aagcgcctgggcctggatgagttcaacttcatcaaggtgttgggcaaaggcagctttggc
aaggtcatgttggcagaactcaagggcaaagatgaagtatatgctgtgaaggtcttaaag
aaggacgtcatccttcaggatgatgacgtggactgcacaatgacagagaagaggattttg
gctctggcacggaaacacccgtaccttacccaactctactgctgcttccagaccaaggac
cgcctctttttcgtcatggaatatgtaaatggtggagacctcatgtttcagattcagcgc
tcccgaaaattcgacgagcctcgttcacggttctatgctgcagaggtcacatcggccctc
atgttcctccaccagcatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggctgacttcgggatgtgcaaggaagggattctgaat
ggtgtgacgaccaccacgttctgtgggactcctgactacatagctcctgagatcctgcag
gagttggagtatggcccctccgtggactggtgggccctgggggtgctgatgtacgagatg
atggctggacagcctccctttgaggccgacaatgaggacgacctatttgagtccatcctc
catgacgacgtgctgtacccagtctggctcagcaaggaggctgtcagcatcttgaaagct
ttcatgacgaagaatccccacaagcgcctgggctgtgtggcatcgcagaatggcgaggac
gccatcaagcagcacccattcttcaaagagattgactgggtgctcctggagcagaagaag
atcaagccacccttcaaaccacgcattaaaaccaaaagagacgtcaataattttgaccaa
gactttacccgggaagagccggtactcacccttgtggacgaagcaattgtaaagcagatc
aaccaggaggaattcaaaggtttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system