KEGG   Homo sapiens (human): 55818Help
Entry
55818             CDS       T01001                                 

Gene name
KDM3A, JHDM2A, JHMD2A, JMJD1, JMJD1A, TSGA
Definition
(RefSeq) lysine demethylase 3A
  KO
K15601  lysine-specific demethylase 3 [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    55818 (KDM3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55818 (KDM3A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     55818 (KDM3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    55818 (KDM3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC C1_2 zf-UDP
Motif
Other DBs
NCBI-GeneID: 55818
NCBI-ProteinID: NP_001140160
OMIM: 611512
HGNC: 20815
Ensembl: ENSG00000115548
Vega: OTTHUMG00000130204
Pharos: Q9Y4C1(Tchem)
UniProt: Q9Y4C1
Position
2p11.2
AA seq 1321 aa AA seqDB search
MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLL
DKAGLGSITSVRFLGDQQRVFLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDE
SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIH
VEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEALRTK
PDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACR
SQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAI
GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDLKQTSLAGEKP
TLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
KNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
EQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
PADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
P
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcacgctcggagaaagttggccggtattggtggggaggaggtttctcagtctg
tccgcagccgacggcagcgatggcagccacgacagctgggacgtggagcgcgtcgccgag
tggccctggctctccgggaccattcgagctgtttcccacaccgacgttaccaagaaggat
ctgaaggtgtgtgtggaatttgatggggaatcttggaggaaaagaagatggatagaagtc
tacagccttctaaggagagcatttttagtagaacataatttggttttagctgaacgaaag
tcacctgaaatttctgaacgaattgtacagtggcctgcaataacgtacaaacctctgttg
gacaaagctggtttgggatccataacttctgttcgctttctgggagatcaacaaagagta
tttctttctaaagaccttttgaagcctatacaggatgtaaacagtcttcgactttctctt
acggataatcagattgtcagtaaagaatttcaagctttgattgtgaagcatttagatgaa
agccatcttttaaaaggtgacaaaaacttagttggttcagaagtaaaaatttatagcttg
gacccatctactcagtggttttcagcaaccgttataaatggaaacccagcatcaaaaact
cttcaagtcaactgtgaggagattccagcactgaaaattgttgatccgtcactgattcat
gttgaagttgtacacgataaccttgtgacatgtggtaattctgcaagaattggagctgta
aaacgcaagtcttctgagaataatggaaccctggtttccaaacaagcaaaatcttgctct
gaggcctctcccagtatgtgtcctgtgcagtctgtacctacaacagtttttaaggagata
ctgcttggctgtactgcggcaactccacctagtaaggacccaagacagcaaagtactccc
caggctgccaactctccacctaaccttggagcaaaaattcctcaaggatgtcataaacaa
agtttaccagaggaaatttcttcctgtctaaatacaaagtctgaagctctgagaacaaaa
ccagatgtctgcaaagcagggttgctctcaaagtcctctcagattggaactggagacttg
aaaattctgactgagccaaaaggcagctgtactcagcctaagacaaacactgatcaggaa
aacagattggagtctgttccacaagcattgactggccttcctaaggagtgcttacctaca
aaggcttcttctaaggcagaattggaaattgccaatcctcctgaactgcagaagcaccta
gaacatgcaccttccccatcggatgtttcaaatgcaccagaagtgaaagcaggtgtcaat
agtgatagccctaataactgttcaggaaaaaaggtagaaccttcagctttagcttgccga
tcacagaatttaaaggaatcttcagtaaaagtagataatgaaagctgttgttcaagaagc
aacaataaaatccagaatgccccatccaggaagtcggttttgacagacccagctaaactc
aaaaagctgcaacagagtggcgaggccttcgtacaggatgattcttgtgtgaacatcgtg
gcacagttgcctaaatgccgagagtgtcgcttggacagtctccgcaaggataaggagcaa
cagaaggactcacctgtgttttgccgcttctttcacttcaggaggttacaattcaacaaa
catggtgtgttgcgggtagaaggcttcttaacaccaaacaagtatgacaatgaagcaatt
ggcttgtggttacctttaaccaaaaacgttgtggggattgatttggacacagcaaagtac
atcttggccaacattggagaccacttctgtcaaatggtgatttctgaaaaggaagctatg
tcaactattgagccacacagacaggttgcttggaagcgagctgtcaaaggtgttcgagaa
atgtgtgatgtgtgcgacaccaccatcttcaacctgcactgggtgtgtcctcggtgtggg
tttggagtatgtgtggactgctaccggatgaagagaaagaattgccaacagggtgctgct
tacaagactttctcttggctaaaatgtgtgaagagtcagatacatgaaccagagaactta
atgcccacacagatcattcctggaaaagcactctatgatgttggagacattgttcattct
gtaagagcgaaatggggaataaaggcaaactgcccttgttcaaacaggcaattcaaactc
ttttcaaagccagcctcaaaggaagacctaaaacagacttctttagctggagaaaaaccg
actcttggtgcagtgctccagcagaatccctcagtgttggagccagcagctgtgggtggg
gaagcagcctccaagccagccggcagcatgaagcctgcctgtccagccagcacatctcct
ctaaactggctggccgacctaaccagcgggaatgtcaacaaggaaaacaaggaaaaacaa
ccaacaatgccaattttaaagaatgaaatcaaatgccttccacccctcccacctttaagc
aaatccagcacagtcctccatacgtttaacagcacaattttgacacccgtaagcaacaac
aattctggtttcctccggaatctcttgaattcttctacaggaaagacagaaaatggactc
aagaatacaccaaaaatccttgatgacatctttgcctctttggtgcaaaataagacgact
tctgatttatctaagaggcctcaaggactaaccatcaagcccagcattctgggctttgac
actcctcactattggctttgtgataatcgcttgctgtgcttgcaagaccccaacaataag
agcaactggaatgtgtttagggagtgctggaaacaagggcagccagtgatggtgtctgga
gtgcatcataaattgaactctgaactttggaaacctgaatccttcaggaaagagtttggt
gagcaggaagtagacctagttaattgtaggaccaatgaaatcatcacaggagccacagta
ggagacttctgggatggatttgaagatgttccaaatcgtttgaaaaatgaaaaagaacca
atggtgttgaaacttaaggactggccaccaggagaagattttagagatatgatgccttcc
aggtttgatgatctgatggccaacattccactgcccgagtacacaaggcgagatggcaaa
ctgaatttggcctctaggctgccaaactactttgttcggccagatctgggccccaagatg
tataatgcttatggattaatcactcctgaagatcggaaatatggaacaacaaatcttcac
ttagatgtatctgatgcagctaatgtcatggtctatgtgggaattcccaaaggacagtgt
gagcaagaagaagaagtccttaagaccatccaagatggagattctgacgaactcacaata
aagcgatttattgaaggaaaagagaagccaggagcactgtggcacatatatgctgcaaag
gacacggagaagataagggaatttcttaaaaaggtatcagaagagcaaggtcaagaaaac
ccagcagaccacgatcctattcatgatcaaagctggtatttagaccgatcattaagaaaa
cgtcttcatcaagagtatggagttcaaggctgggctattgtacagtttcttggggatgtg
gtgtttatcccggcaggagctccacatcaggttcataacttatatagctgcatcaaagtg
gctgaagattttgtttctccagagcatgttaaacactgcttctggcttactcaggaattc
cgatatctgtcacagactcataccaatcacgaagataaattacaggtgaagaatgttatc
taccatgcagtgaaagatgcagttgctatgctgaaagccagtgaatccagttttggcaaa
ccttaa

DBGET integrated database retrieval system