KEGG   Homo sapiens (human): 5582Help
Entry
5582              CDS       T01001                                 

Gene name
PRKCG, PKC-gamma, PKCC, PKCG, SCA14
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04650  Natural killer cell mediated cytotoxicity
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
Network
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
Disease
H00063  Spinocerebellar ataxia (SCA)
Drug target
Midostaurin: D05029
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5582 (PRKCG)
   04015 Rap1 signaling pathway
    5582 (PRKCG)
   04010 MAPK signaling pathway
    5582 (PRKCG)
   04012 ErbB signaling pathway
    5582 (PRKCG)
   04310 Wnt signaling pathway
    5582 (PRKCG)
   04370 VEGF signaling pathway
    5582 (PRKCG)
   04066 HIF-1 signaling pathway
    5582 (PRKCG)
   04020 Calcium signaling pathway
    5582 (PRKCG)
   04070 Phosphatidylinositol signaling system
    5582 (PRKCG)
   04071 Sphingolipid signaling pathway
    5582 (PRKCG)
   04150 mTOR signaling pathway
    5582 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5582 (PRKCG)
   04540 Gap junction
    5582 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5582 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    5582 (PRKCG)
   04670 Leukocyte transendothelial migration
    5582 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    5582 (PRKCG)
   04921 Oxytocin signaling pathway
    5582 (PRKCG)
   04918 Thyroid hormone synthesis
    5582 (PRKCG)
   04919 Thyroid hormone signaling pathway
    5582 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    5582 (PRKCG)
   04916 Melanogenesis
    5582 (PRKCG)
   04925 Aldosterone synthesis and secretion
    5582 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5582 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    5582 (PRKCG)
   04971 Gastric acid secretion
    5582 (PRKCG)
   04972 Pancreatic secretion
    5582 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5582 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5582 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    5582 (PRKCG)
   04727 GABAergic synapse
    5582 (PRKCG)
   04725 Cholinergic synapse
    5582 (PRKCG)
   04728 Dopaminergic synapse
    5582 (PRKCG)
   04726 Serotonergic synapse
    5582 (PRKCG)
   04720 Long-term potentiation
    5582 (PRKCG)
   04730 Long-term depression
    5582 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    5582 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5582 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5582 (PRKCG)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    5582 (PRKCG)
   05231 Choline metabolism in cancer
    5582 (PRKCG)
   05206 MicroRNAs in cancer
    5582 (PRKCG)
   05205 Proteoglycans in cancer
    5582 (PRKCG)
   05225 Hepatocellular carcinoma
    5582 (PRKCG)
   05214 Glioma
    5582 (PRKCG)
   05223 Non-small cell lung cancer
    5582 (PRKCG)
  09164 Substance dependence
   05031 Amphetamine addiction
    5582 (PRKCG)
   05032 Morphine addiction
    5582 (PRKCG)
  09167 Infectious diseases
   05161 Hepatitis B
    5582 (PRKCG)
   05163 Human cytomegalovirus infection
    5582 (PRKCG)
   05146 Amoebiasis
    5582 (PRKCG)
   05143 African trypanosomiasis
    5582 (PRKCG)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5582 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5582 (PRKCG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5582 (PRKCG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5582 (PRKCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase C1_1 Pkinase_Tyr C2 Pkinase_C Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5582
NCBI-ProteinID: NP_002730
OMIM: 176980
HGNC: 9402
Ensembl: ENSG00000126583
Vega: OTTHUMG00000064846
Pharos: P05129(Tchem)
UniProt: P05129
Structure
PDB: 

Position
19q13.42
AA seq 697 aa AA seqDB search
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctgggccccggcgtaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggccctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaaa
cacaagttccgcctgcatagctacagcagccccaccttctgcgaccactgtggctccctc
ctctacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggagatccgggctcccacagcagatgagatccacgtaactgttggcgaggcc
cgtaacctaattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacggtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaacctgaagccaggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggggccatgtcc
tttggcgtctcggagctgctcaaggcgcccgtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcgagtccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctctgatgagctctacgccatcaag
atcttgaaaaaggacgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgtgtgctggcgctggggggccggggtcctggcggccggccccacttcctcacccagctc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcggcagaaatcgctatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgactttggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgag
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system