KEGG   Homo sapiens (human): 55824Help
Entry
55824             CDS       T01001                                 

Gene name
PAG1, CBP, PAG
Definition
(RefSeq) phosphoprotein membrane anchor with glycosphingolipid microdomains 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PAG Cadherin_C_2 MAP17
Motif
Other DBs
NCBI-GeneID: 55824
NCBI-ProteinID: NP_060910
OMIM: 605767
HGNC: 30043
Ensembl: ENSG00000076641
Vega: OTTHUMG00000164592
Pharos: Q9NWQ8(Tbio)
UniProt: Q9NWQ8
Position
8q21.13
AA seq 432 aa AA seqDB search
MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVP
SDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQD
STGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCL
YETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSV
NVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYK
SREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYA
TVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESI
SDLQQGRDITRL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgcggggagcctgctgggcagcggacagatgcagatcaccctgtggggaagt
ctggctgctgtcgccattttcttcgtcatcaccttcctcatcttcctgtgctctagttgt
gacagggaaaagaagccgcgacagcatagtggggaccatgagaacctgatgaacgtgcct
tcagacaaggagatgttcagccgttcagttactagcctggcaacagatgctcctgccagc
agtgagcagaatggggcactcaccaatggggacattctttcagaggacagtactctgacc
tgcatgcagcattacgaggaagtccagacatcggcctcggatctgctggattcccaggac
agcacagggaaaccaaaatgtcatcagagtcgggagctgcccagaatccctcccgagagc
gcagtggataccatgctcacggcgagaagtgtggacggggaccaggggctggggatggaa
gggccctatgaagtgctcaaggacagctcctcccaagaaaacatggtggaggactgcttg
tatgaaactgtgaaagagatcaaggaggtggctgcagctgcacacctggagaaaggccac
agtggcaaggcaaaatctacttctgcctcgaaagagctcccagggccccagactgaaggc
aaagctgagtttgctgaatatgcctcggtggacagaaacaaaaaatgtcgtcaaagtgtt
aatgtagagagtatccttggaaattcatgtgatccagaagaggaggccccaccacctgtc
cctgttaagcttctggacgagaatgaaaaccttcaggagaaggaagggggagaggcggaa
gagagtgccacagacacgaccagtgaaactaacaagagatttagctcattgtcatacaag
tctcgggaagaagaccccactctcacagaagaagagatctcagctatgtactcatcagta
aataaacctggacagttagtgaataaatcggggcagtcgcttacagttccggagtccacc
tacacctccattcaaggggacccacagaggtcaccctcctcctgtaatgatctctatgct
actgttaaagacttcgaaaaaactccaaacagcacacttccaccagcagggaggcccagc
gaggagccagagcctgattatgaagcgatacagactctcaacagagaggaagaaaaggcc
accctggggaccaatggccaccacggtctcgtcccaaaggagaacgactacgagagcata
agtgacttgcagcaaggcagagatattaccaggctctag

DBGET integrated database retrieval system