KEGG   Homo sapiens (human): 5583Help
Entry
5583              CDS       T01001                                 

Gene name
PRKCH, PKC-L, PKCL, PRKCL, nPKC-eta
Definition
(RefSeq) protein kinase C eta
  KO
K18051  novel protein kinase C eta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Sotrastaurin (DG01406): D09671 D09718
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5583 (PRKCH)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5583 (PRKCH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5583 (PRKCH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5583 (PRKCH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5583 (PRKCH)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5583 (PRKCH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5583 (PRKCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C Kinase-like C1_2 FTA2 Haspin_kinase APH Kdo
Motif
Other DBs
NCBI-GeneID: 5583
NCBI-ProteinID: NP_006246
OMIM: 605437
HGNC: 9403
Ensembl: ENSG00000027075
Vega: OTTHUMG00000152341
Pharos: P24723(Tchem)
UniProt: P24723
Structure
PDB: 

Position
14q23.1
AA seq 683 aa AA seqDB search
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctggcaccatgaagttcaatggctatttgagggtccgcatcggtgaggcagtg
gggctgcagcccacccgctggtccctgcgccactcgctcttcaagaagggccaccagctg
ctggacccctatctgacggtgagcgtggaccaggtgcgcgtgggccagaccagcaccaag
cagaagaccaacaaacccacgtacaacgaggagttttgcgctaacgtcaccgacggcggc
cacctcgagttggccgtcttccacgagacgcccctgggctacgaccacttcgtggccaac
tgcaccctgcagttccaggagctgctgcgcacgaccggcgcctcggacaccttcgagggt
tgggtggatctcgagccagaggggaaagtatttgtggtaataacccttaccgggagtttc
actgaagctactctccagagagaccggatcttcaaacattttaccaggaagcgccaaagg
gctatgcgaaggcgagtccaccagatcaatggacacaagttcatggccacgtatctgagg
cagcccacctactgctctcactgcagggagtttatctggggagtgtttgggaaacagggt
tatcagtgccaagtgtgcacctgtgtcgtccataaacgctgccatcatctaattgttaca
gcctgtacttgccaaaacaatattaacaaagtggattcaaagattgcagaacagaggttc
gggatcaacatcccacacaagttcagcatccacaactacaaagtgccaacattctgcgat
cactgtggctcactgctctggggaataatgcgacaaggacttcagtgtaaaatatgtaaa
atgaatgtgcatattcgatgtcaagcgaacgtggcccctaactgtggggtaaatgcggtg
gaacttgccaagaccctggcagggatgggtctccaacccggaaatatttctccaacctcg
aaactcgtttccagatcgaccctaagacgacagggaaaggagagcagcaaagaaggaaat
gggattggggttaattcttccaaccgacttggtatcgacaactttgagttcatccgagtg
ttggggaaggggagttttgggaaggtgatgcttgcaagagtaaaagaaacaggagacctc
tatgctgtgaaggtgctgaagaaggacgtgattctgcaggatgatgatgtggaatgcacc
atgaccgagaaaaggatcctgtctctggcccgcaatcaccccttcctcactcagttgttc
tgctgctttcagacccccgatcgtctgttttttgtgatggagtttgtgaatgggggtgac
ttgatgttccacattcagaagtctcgtcgttttgatgaagcacgagctcgcttctatgct
gcagaaatcatttcggctctcatgttcctccatgataaaggaatcatctatagagatctg
aaactggacaatgtcctgttggaccacgagggtcactgtaaactggcagacttcggaatg
tgcaaggaggggatttgcaatggtgtcaccacggccacattctgtggcacgccagactat
atcgctccagagatcctccaggaaatgctgtacgggcctgcagtagactggtgggcaatg
ggcgtgttgctctatgagatgctctgtggtcacgcgccttttgaggcagagaacgaagat
gacctctttgaggccatactgaatgatgaggtggtctaccctacctggctccatgaagat
gccacagggatcctaaaatctttcatgaccaagaaccccaccatgcgcttgggcagcctg
actcagggaggcgagcacgccatcttgagacatcctttttttaaggaaatcgactgggcc
cagctgaaccatcgccaaatagaaccgcctttcagacccagaatcaaatcccgagaagat
gtcagtaattttgaccctgacttcataaaggaagagccagttttaactccaattgatgag
ggacatcttccaatgattaaccaggatgagtttagaaacttttcctatgtgtctccagaa
ttgcaaccatag

DBGET integrated database retrieval system