KEGG   Homo sapiens (human): 55832Help
Entry
55832             CDS       T01001                                 

Gene name
CAND1, TIP120, TIP120A
Definition
(RefSeq) cullin associated and neddylation dissociated 1
  KO
K17263  cullin-associated NEDD8-dissociated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55832 (CAND1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55832 (CAND1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    55832 (CAND1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55832 (CAND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIP120 HEAT_2 HEAT_EZ HEAT UME Vac14_Fab1_bd CLASP_N Adaptin_N MMS19_C Telomere_reg-2 Cnd1 RTP1_C1 DUF3385 MMS19_N DRIM VHS V-ATPase_H_C Uso1_p115_head RRN3 GhoS
Motif
Other DBs
NCBI-GeneID: 55832
NCBI-ProteinID: NP_060918
OMIM: 607727
HGNC: 30688
Ensembl: ENSG00000111530
Vega: OTTHUMG00000169060
Pharos: Q86VP6(Tbio)
UniProt: Q86VP6
Structure
PDB: 

Position
12q14.3-q15
AA seq 1230 aa AA seqDB search
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK
NGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPA
SSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCL
LPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAA
ISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINI
CLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
VSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ
GETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGI
IFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEAL
LVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNL
GDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLR
KNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLA
KVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLT
GPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL
SLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEIT
SQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTL
IDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDL
NVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLD
IRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQ
RLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQS
QISSNPELAAIFESIQKDSSSTNLESMDTS
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgcctcgtaccacatttccaatttgctggaaaaaatgacatccagcgacaag
gactttaggtttatggctacaaatgatttgatgacggaactgcagaaagattccatcaag
ttggatgatgatagtgaaaggaaagtagtgaaaatgattttgaagttattggaagataaa
aatggagaggtacagaatttagctgtcaaatgtcttggtcctttagtgagtaaagtgaaa
gaataccaagtagagacaattgtagataccctctgcactaacatgctttctgataaagaa
caacttcgagacatttcaagtattggtcttaaaacagtaattggagaacttcctccagct
tccagtggctctgcattagctgctaatgtatgtaaaaagattactggacgtcttacaagt
gcaatagcaaaacaggaagatgtctctgttcagctagaagccttggatattatggctgat
atgttgagcaggcaaggaggacttcttgttaatttccatccttcaattctgacctgtcta
cttccccagttgaccagccctagacttgcagtgaggaaaagaaccattatcgctcttggc
catctggttatgagctgtggaaatatagtttttgtagatcttattgaacatctgttgtca
gagttgtccaaaaatgattctatgtcaacaacaagaacctacatacaatgtattgctgct
attagtaggcaagctggtcatagaataggtgaataccttgagaagataattcctttggtg
gtaaaattttgcaatgtagatgatgatgaattaagagagtactgtattcaagcctttgaa
tcatttgtaagaagatgtcctaaggaagtatatcctcatgtttctaccattataaatatt
tgtcttaaatatcttacctatgatccaaattataattacgatgatgaagatgaagatgaa
aatgcaatggatgctgatggtggtgatgatgatgatcaagggagtgatgatgaatacagt
gatgatgatgacatgagttggaaagtgagacgtgcagctgcgaagtgcttggatgctgta
gttagcacaaggcatgaaatgcttccagaattctacaagaccgtctctcctgcactaata
tccagatttaaagagcgtgaagagaatgtaaaggcagatgtttttcacgcatacctttct
cttttgaagcaaactcgtcctgtacaaagttggctatgtgaccctgatgcaatggagcag
ggagaaacacctttaacaatgcttcagagtcaggttcccaacattgttaaagctcttcac
aaacagatgaaagaaaaaagtgtgaagacccgacagtgttgttttaacatgttaactgag
ctggtaaatgtattacctggggccctaactcaacacattcctgtacttgtaccaggaatc
attttctcactgaatgataaatcaagctcatcgaatttgaagatcgatgctttgtcatgt
ctatacgtaatcctctgtaaccattctcctcaagtcttccatcctcacgttcaggctttg
gttcctccagtggtggcttgtgttggagacccattttacaaaattacatctgaagcactt
cttgttactcaacagcttgtcaaagtaattcgtcctttagatcagccttcctcgtttgat
gcaactccttatatcaaagatctatttacctgtaccattaagagattaaaagcagctgac
attgatcaggaagtcaaggaaagggctatttcctgtatgggacaaattatttgcaacctt
ggagacaatttgggttctgacttgcctaatacacttcagattttcttggagagactaaag
aatgaaattaccaggttaactacagtaaaggcattgacactgattgctgggtcacctttg
aagatagatttgaggcctgttctgggagaaggggttcctatccttgcttcatttcttaga
aaaaaccagagagctttgaaactgggtactctttctgcccttgatattctaataaaaaac
tatagtgacagcttgacagctgccatgattgatgcagttctagatgagctcccacctctt
atcagcgaaagtgatatgcatgtttcacaaatggccatcagttttcttaccactttggca
aaagtatatccctcctccctttcaaagataagtggatccattctcaatgaacttattgga
cttgtgagatcacccttattgcaggggggagctcttagtgccatgctagactttttccaa
gctctggttgtcactggaacaaataatttaggatacatggatttgttgcgcatgctgact
ggtccagtttactctcagagcacagctcttactcataagcagtcttattattccattgcc
aaatgtgtagctgcccttactcgagcatgccctaaagagggaccagctgtagtaggtcag
tttattcaagatgtcaagaactcaaggtctacagattccattcgtctcttagctctactt
tctcttggagaagttgggcatcatattgacttaagtggacagttggaactaaaatctgta
atactagaagctttctcatctcctagtgaagaagtcaaatcagctgcatcctatgcatta
ggcagcattagtgtgggcaaccttcctgaatatctgccgtttgtcctgcaagaaataact
agtcaacccaaaaggcagtatcttttacttcattccttgaaggaaattattagctctgca
tcagtggtgggccttaaaccatatgttgaaaacatctgggccttattactaaagcactgt
gagtgtgcagaggaaggaaccagaaatgttgttgctgaatgtctaggaaaactcactcta
attgatccagaaactctccttccacggcttaaggggtacttgatatcaggctcatcatat
gcccgaagctcagtggttacggctgtgaaatttacaatttctgaccatccacaacctatt
gatccactgttaaagaactgcataggtgatttcctaaaaactttggaagacccagatttg
aatgtgagaagagtagccttggtcacatttaattcagcagcacataacaagccatcatta
ataagggatctattggatactgttcttccacatctttacaatgaaacaaaagttagaaag
gagcttataagagaggtagaaatgggtccatttaaacatacggttgatgatggtctggat
attagaaaggcagcatttgagtgtatgtacacacttctagacagttgtcttgatagactt
gatatctttgaatttctaaatcatgttgaagatggtttgaaggaccattatgatattaag
atgctgacatttttaatgttggtgagactgtctaccctttgtccaagtgcagtactgcag
aggttggaccgacttgttgagccattacgtgcaacatgtacaactaaggtaaaggcaaac
tcagtaaagcaggagtttgaaaaacaagatgaattaaagcgatctgccatgagagcagta
gcagcactgctaaccattccagaagcagagaagagtccactgatgagtgaattccagtca
cagatcagttctaaccctgagctggcggctatctttgaaagtatccagaaagattcatca
tctactaacttggaatcaatggacactagttag

DBGET integrated database retrieval system