KEGG   Homo sapiens (human): 5584Help
Entry
5584              CDS       T01001                                 

Gene name
PRKCI, DXS1179E, PKCI, nPKC-iota
Definition
(RefSeq) protein kinase C iota
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04910  Insulin signaling pathway
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5584 (PRKCI)
   04390 Hippo signaling pathway
    5584 (PRKCI)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5584 (PRKCI)
  Cellular community - eukaryotes
   04530 Tight junction
    5584 (PRKCI)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5584 (PRKCI)
  Endocrine system
   04910 Insulin signaling pathway
    5584 (PRKCI)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    5584 (PRKCI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5584 (PRKCI)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5584 (PRKCI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 PB1 Pkinase_C Kinase-like Haspin_kinase Kdo C1_2 APH FTA2
Motif
Other DBs
NCBI-GeneID: 5584
NCBI-ProteinID: NP_002731
OMIM: 600539
HGNC: 9404
Ensembl: ENSG00000163558
Vega: OTTHUMG00000150214
Pharos: P41743(Tbio)
UniProt: P41743
Structure
PDB: 

Position
3q26.2
AA seq 596 aa AA seqDB search
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtcccacacggtcgcaggcggcggcagcggg
gaccattcccaccaggtccgggtgaaagcctactaccgcggggatatcatgataacacat
tttgaaccttccatctcctttgagggcctttgcaatgaggttcgagacatgtgttctttt
gacaacgaacagctcttcaccatgaaatggatagatgaggaaggagacccgtgtacagta
tcatctcagttggagttagaagaagcctttagactttatgagctaaacaaggattctgaa
ctcttgattcatgtgttcccttgtgtaccagaacgtcctgggatgccttgtccaggagaa
gataaatccatctaccgtagaggtgcacgccgctggagaaagctttattgtgccaatggc
cacactttccaagccaagcgtttcaacaggcgtgctcactgtgccatctgcacagaccga
atatggggacttggacgccaaggatataagtgcatcaactgcaaactcttggttcataag
aagtgccataaactcgtcacaattgaatgtgggcggcattctttgccacaggaaccagtg
atgcccatggatcagtcatccatgcattctgaccatgcacagacagtaattccatataat
ccttcaagtcatgagagtttggatcaagttggtgaagaaaaagaggcaatgaacaccagg
gaaagtggcaaagcttcatccagtctaggtcttcaggattttgatttgctccgggtaata
ggaagaggaagttatgccaaagtactgttggttcgattaaaaaaaacagatcgtatttat
gcaatgaaagttgtgaaaaaagagcttgttaatgatgatgaggatattgattgggtacag
acagagaagcatgtgtttgagcaggcatccaatcatcctttccttgttgggctgcattct
tgctttcagacagaaagcagattgttctttgttatagagtatgtaaatggaggagaccta
atgtttcatatgcagcgacaaagaaaacttcctgaagaacatgccagattttactctgca
gaaatcagtctagcattaaattatcttcatgagcgagggataatttatagagatttgaaa
ctggacaatgtattactggactctgaaggccacattaaactcactgactacggcatgtgt
aaggaaggattacggccaggagatacaaccagcactttctgtggtactcctaattacatt
gctcctgaaattttaagaggagaagattatggtttcagtgttgactggtgggctcttgga
gtgctcatgtttgagatgatggcaggaaggtctccatttgatattgttgggagctccgat
aaccctgaccagaacacagaggattatctcttccaagttattttggaaaaacaaattcgc
ataccacgttctctgtctgtaaaagctgcaagtgttctgaagagttttcttaataaggac
cctaaggaacgattgggttgtcatcctcaaacaggatttgctgatattcagggacacccg
ttcttccgaaatgttgattgggatatgatggagcaaaaacaggtggtacctccctttaaa
ccaaatatttctggggaatttggtttggacaactttgattctcagtttactaatgaacct
gtccagctcactccagatgacgatgacattgtgaggaagattgatcagtctgaatttgaa
ggttttgagtatatcaatcctcttttgatgtctgcagaagaatgtgtctga

DBGET integrated database retrieval system