KEGG   Homo sapiens (human): 55840Help
Entry
55840             CDS       T01001                                 

Gene name
EAF2, BM040, TRAITS, U19
Definition
(RefSeq) ELL associated factor 2
  KO
K15186  ELL-associated factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55840 (EAF2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     55840 (EAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EAF Paf1 BBP1_C Lin-8 PAN_3 Macoilin
Motif
Other DBs
NCBI-GeneID: 55840
NCBI-ProteinID: NP_060926
OMIM: 607659
HGNC: 23115
Ensembl: ENSG00000145088
Vega: OTTHUMG00000159424
Pharos: Q96CJ1(Tbio)
UniProt: Q96CJ1
Position
3q13.33
AA seq 260 aa AA seqDB search
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVT
ITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKI
QYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSS
DSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGL
LMNTLRNDLQLSESGSDSDD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgcagcgggattctcacacctagaccgtcgcgagcgggttctcaagttaggg
gagagtttcgagaagcagccgcgctgcgccttccacactgtgcgctatgacttcaaacct
gcttctattgacacttcttctgaaggataccttgaggttggtgaaggtgaacaggtgacc
ataactctgccaaatatagaaggttcaactccaccagtaactgttttcaaaggttcaaaa
aaaccttacttaaaagaatgcattttgattattaaccatgatactggagaatgtcggcta
gaaaaactcagcagcaacatcactgtaaaaaaaacaagagttgaaggaagcagtaaaatt
cagtatcgtaaagaacaacagcaacaacaaatgtggaattcagccaggactcccaatctt
gtaaaacattctccatctgaagataagatgtccccagcatctccaatagatgatatcgaa
agagaactgaaggcagaagctagtctaatggaccagatgagtagttgtgatagttcatca
gattccaaaagttcatcatcttcaagtagtgaggatagttctagtgactcagaagatgaa
gattgcaaatcctctacttctgatacagggaattgtgtctcaggacatcctaccatgaca
cagtacaggattcctgatatagatgccagtcataatagatttcgagacaacagtggcctt
ctgatgaatactttaagaaatgatttgcagctgagtgaatcaggaagtgacagtgatgac
tga

DBGET integrated database retrieval system