KEGG   Homo sapiens (human): 55845
Entry
55845             CDS       T01001                                 

Gene name
BRK1, C3orf10, HSPC300, MDS027, hHBrk1
Definition
(RefSeq) BRICK1 subunit of SCAR/WAVE actin nucleating complex
  KO
K05752  chromosome 3 open reading frame 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    55845 (BRK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    55845 (BRK1)
   05132 Salmonella infection
    55845 (BRK1)
SSDB
Motif
Pfam: CCDC53 MerR-DNA-bind
Other DBs
NCBI-GeneID: 55845
NCBI-ProteinID: NP_060932
OMIM: 611183
HGNC: 23057
Ensembl: ENSG00000254999
Vega: OTTHUMG00000155400
Pharos: Q8WUW1(Tbio)
UniProt: Q8WUW1
Structure
PDB: 
3P8C 4N78

Position
3p25.3
AA seq 75 aa
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR
IEYIEARVTKGETLT
NT seq 228 nt   +upstreamnt  +downstreamnt
atggcgggacaggaggatccggtgcagcgggagattcaccaggactgggctaaccgggag
tacattgagataatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat
atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga
atagagtacattgaagctcgggtgacaaaaggtgagacactcacctag

DBGET integrated database retrieval system