KEGG   Homo sapiens (human): 55845Help
Entry
55845             CDS       T01001                                 

Gene name
BRK1, C3orf10, HSPC300, MDS027, hHBrk1
Definition
(RefSeq) BRICK1 subunit of SCAR/WAVE actin nucleating complex
  KO
K05752  chromosome 3 open reading frame 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    55845 (BRK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    55845 (BRK1)
   05132 Salmonella infection
    55845 (BRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CCDC53 MerR-DNA-bind
Motif
Other DBs
NCBI-GeneID: 55845
NCBI-ProteinID: NP_060932
OMIM: 611183
HGNC: 23057
Ensembl: ENSG00000254999
Vega: OTTHUMG00000155400
Pharos: Q8WUW1(Tbio)
UniProt: Q8WUW1
Structure
PDB: 

Position
3p25.3
AA seq 75 aa AA seqDB search
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR
IEYIEARVTKGETLT
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacaggaggatccggtgcagcgggagattcaccaggactgggctaaccgggag
tacattgagataatcaccagcagcatcaagaaaatcgcagactttctcaactcgttcgat
atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga
atagagtacattgaagctcgggtgacaaaaggtgagacactcacctag

DBGET integrated database retrieval system