KEGG   Homo sapiens (human): 55847Help
Entry
55847             CDS       T01001                                 

Gene name
CISD1, C10orf70, MDS029, ZCD1, mitoNEET
Definition
(RefSeq) CDGSH iron sulfur domain 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CDGSH MitoNEET_N
Motif
Other DBs
NCBI-GeneID: 55847
NCBI-ProteinID: NP_060934
OMIM: 611932
HGNC: 30880
Ensembl: ENSG00000122873
Vega: OTTHUMG00000018266
Pharos: Q9NZ45(Tchem)
UniProt: Q9NZ45 A0A024QZN7
Structure
PDB: 

Position
10q21.1
AA seq 108 aa AA seqDB search
MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAF
DMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgacttccagttccagcgtacgagttgaatggatcgcagcagttaccattgct
gctgggacagctgcaattggttatctagcttacaaaagattttatgttaaagatcatcga
aataaagctatgataaaccttcacatccagaaagacaaccccaagatagtacatgctttt
gacatggaggatttgggagataaagctgtgtactgccgttgttggaggtccaaaaagttc
ccattctgtgatggggctcacacaaaacataacgaagagactggagacaatgtgggccct
ctgatcatcaagaaaaaagaaacttaa

DBGET integrated database retrieval system