KEGG   Homo sapiens (human): 55847
Entry
55847             CDS       T01001                                 

Gene name
CISD1, C10orf70, MDS029, ZCD1, mitoNEET
Definition
(RefSeq) CDGSH iron sulfur domain 1
  KO
K23885  CDGSH iron-sulfur domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    55847 (CISD1)
SSDB
Motif
Pfam: zf-CDGSH MitoNEET_N
Other DBs
NCBI-GeneID: 55847
NCBI-ProteinID: NP_060934
OMIM: 611932
HGNC: 30880
Ensembl: ENSG00000122873
Vega: OTTHUMG00000018266
Pharos: Q9NZ45(Tchem)
UniProt: Q9NZ45 A0A024QZN7
Structure
PDB: 

Position
10q21.1
AA seq 108 aa
MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAF
DMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
NT seq 327 nt   +upstreamnt  +downstreamnt
atgagtctgacttccagttccagcgtacgagttgaatggatcgcagcagttaccattgct
gctgggacagctgcaattggttatctagcttacaaaagattttatgttaaagatcatcga
aataaagctatgataaaccttcacatccagaaagacaaccccaagatagtacatgctttt
gacatggaggatttgggagataaagctgtgtactgccgttgttggaggtccaaaaagttc
ccattctgtgatggggctcacacaaaacataacgaagagactggagacaatgtgggccct
ctgatcatcaagaaaaaagaaacttaa

KEGG   Homo sapiens (human): 493856
Entry
493856            CDS       T01001                                 

Gene name
CISD2, ERIS, Miner1, NAF-1, WFS2, ZCD2
Definition
(RefSeq) CDGSH iron sulfur domain 2
  KO
K23882  CDGSH iron-sulfur domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
Disease
H00854  Wolfram syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    493856 (CISD2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    493856 (CISD2)
SSDB
Motif
Pfam: MitoNEET_N zf-CDGSH DUF5787 PGA2
Other DBs
NCBI-GeneID: 493856
NCBI-ProteinID: NP_001008389
OMIM: 611507
HGNC: 24212
Ensembl: ENSG00000145354
Vega: OTTHUMG00000161014
Pharos: Q8N5K1(Tbio)
UniProt: Q8N5K1
Structure
PDB: 
4OOA 4OO7 3FNV

Position
4q24
AA seq 135 aa
MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFL
PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNEL
TGDNVGPLILKKKEV
NT seq 408 nt   +upstreamnt  +downstreamnt
atggtgctggagagcgtggcccgtatcgtgaaggtgcagctccctgcatatctgaagcgg
ctcccagtccctgaaagcattaccgggttcgctaggctcacagtttcagaatggcttcgg
ttattgcctttccttggtgtactcgcacttcttggctaccttgcagttcgtccattcctc
ccgaagaagaaacaacagaaggatagcttgattaatcttaaaatacaaaaggaaaatccg
aaagtagtgaatgaaataaacattgaagatttgtgtcttactaaagcagcttattgtagg
tgttggcgttctaaaacgtttcctgcctgcgatggttcacataataaacacaatgaattg
acaggagataatgtgggtccactaatactgaagaagaaagaagtataa

KEGG   Homo sapiens (human): 23197
Entry
23197             CDS       T01001                                 

Gene name
FAF2, ETEA, UBXD8, UBXN3B
Definition
(RefSeq) Fas associated factor family member 2
  KO
K18726  FAS-associated factor 2
Organism
hsa  Homo sapiens (human)
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23197 (FAF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     23197 (FAF2)
SSDB
Motif
Pfam: UBA_4 UBX DUF1682 Thioredoxin_7 PEHE
Other DBs
NCBI-GeneID: 23197
NCBI-ProteinID: NP_055428
OMIM: 616935
HGNC: 24666
Ensembl: ENSG00000113194
Vega: OTTHUMG00000163228
Pharos: Q96CS3(Tbio)
UniProt: Q96CS3
Structure
PDB: 
2DAM

Position
5q35.2
AA seq 445 aa
MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRF
IRPDPRSRVTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGD
DHQDSDEFCRNTLCAPEVISLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKD
RRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS
LRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPE
SVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW
PNPPTLQEAGLSHTEVLFVQDLTDE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcggcgcctgaggagcgggatctaacccaggagcagacagagaagctgctgcagttt
caggatctcactggcatcgaatctatggatcagtgtcgccataccttggaacagcataac
tggaacatagaggctgctgtacaggacagattgaatgagcaagagggcgtacctagtgtt
ttcaacccacctccatcacgacccctgcaggttaatacagctgaccacaggatctacagc
tatgttgtctcaagacctcaaccaagggggctgcttggatggggttattacttgataatg
cttccattccggtttacctattacacgatacttgatatatttaggtttgctcttcgtttt
atacggcctgaccctcgcagccgggtcactgaccccgttggggacattgtttcatttatg
cactcttttgaagagaaatatgggagggcacaccctgtcttctaccagggaacgtacagc
caggcacttaacgatgccaaaagggagcttcgctttcttttggtttatcttcatggagat
gatcaccaggactctgatgagttttgtcgcaacacactctgtgcacctgaagttatttca
ctaataaacactaggatgctcttctgggcatgctctacaaacaaacctgagggatacagg
gtctcacaggctttacgagagaacacctatccattcctggccatgattatgctgaaggat
cgaaggatgactgtggtgggacggctagaaggcctcattcaacctgatgacctcattaac
caactgacatttatcatggatgctaaccagacttacctggtgtcagaacgcctagaaagg
gaagaaagaaaccagacccaagtgctgagacaacagcaggatgaggcctacctggcctct
ctcagagctgaccaggagaaagaaagaaagaaacgggaggagcgggagcgtaagcggcgg
aaggaggaggaggtgcaacagcaaaagttggcagaggagagacggcggcagaatttacag
gaggaaaaggaaaggaagttggaatgcctgccccctgaaccttcccctgatgaccctgaa
agtgtcaagatcatcttcaaattacctaatgattctcgagtagagagacgattccacttt
tcacagtctctaacagtaatccacgacttcttattctccttgaaggaaagcccagaaaag
tttcagattgaagccaattttcccaggcgagtgctgccctgcatcccttcagaggagtgg
cccaatccccctacgctacaggaggccggactcagccacacagaagttctttttgttcag
gacctaactgacgaatga

KEGG   Homo sapiens (human): 23770
Entry
23770             CDS       T01001                                 

Gene name
FKBP8, FKBP38, FKBPr38
Definition
(RefSeq) FKBP prolyl isomerase 8
  KO
K09574  FK506-binding protein 8 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23770 (FKBP8)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    23770 (FKBP8)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     23770 (FKBP8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     23770 (FKBP8)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    23770 (FKBP8)
SSDB
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_14 TPR_16 Fis1_TPR_C TPR_11 TPR_9 TPR_8 TPR_7 TPR_19 TPR_17 TPR_12 ANAPC3 TPR_20 TPR_6 NARP1
Other DBs
NCBI-GeneID: 23770
NCBI-ProteinID: NP_001295302
OMIM: 604840
HGNC: 3724
Ensembl: ENSG00000105701
Vega: OTTHUMG00000183368
Pharos: Q14318(Tbio)
UniProt: Q14318 A0A024R7P2 B2R8G6
Structure
PDB: 

Position
19p13.11
AA seq 412 aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQ
PPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKG
QVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLA
ANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLE
HQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTE
TALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcatcgtgtgctgaaccctctgagccctctgccccactgcccgccggggtcccaccg
ctcgaggacttcgaggtactggatggggttgaggatgcagagggtgaggaggaagaggag
gaggaagaggaggaagaggatgacctgagtgagctgccaccgctggaggacatgggacaa
cccccggcggaggaggctgagcagcctggggccctggcccgagagttccttgctgccatg
gagcccgagcccgccccagccccggccccagaagagtggctggacattctggggaacggg
ctgttgaggaagaagacgctggtcccagggccgccaggttcgagccgcccggtcaagggc
caggtggtcaccgtacatctgcagacgtcgctggagaatggcacacgggtgcaggaggag
ccggagctggtgttcactctgggtgactgtgacgtcatccaggccctggatctcagtgtc
ccactcatggacgtgggggagacggccatggtcactgctgactccaagtactgctacggc
ccccaaggcaggagcccatacatccccccgcacgcggccctgtgcctggaggtgaccctg
aagacggctgtggacgggcctgacctggagatgctcacggggcaggagcgcgtggccctg
gccaaccggaagcgggagtgcggcaacgcccactaccagcgggcggacttcgtcctggcc
gccaactcctacgacctcgccatcaaggctatcacctccagcgccaaagtggacatgacg
ttcgaggaggaggcacagctcctgcagttgaaggtgaagtgtctgaacaacctggcggcc
tcgcagctgaagctcgaccactaccgcgcagccctgcgctcctgcagccttgtgctggag
caccagccagacaacatcaaggctctcttccgcaagggcaaggtgctggcccagcagggg
gagtacagtgaggccatccccatcctgagggcagccctgaagctggaaccttccaacaag
acgatccacgcagagctctcaaagctggtgaagaagcatgcggcgcagcggagcacggag
accgccttgtaccggaaaatgctgggcaaccccagccggctgcctgctaagtgccctggc
aagggtgcctggtccatcccatggaagtggctgtttggggcgactgctgttgccttgggg
ggtgtggcactctctgtggtcatcgctgccaggaactga

KEGG   Homo sapiens (human): 9868
Entry
9868              CDS       T01001                                 

Gene name
TOMM70, TOMM70A, Tom70
Definition
(RefSeq) translocase of outer mitochondrial membrane 70
  KO
K17768  mitochondrial import receptor subunit TOM70
Organism
hsa  Homo sapiens (human)
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9868 (TOMM70)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9868 (TOMM70)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    9868 (TOMM70)
Transporters [BR:hsa02000]
 Other transporters
  Primary active transporters [TC:3]
   9868 (TOMM70)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 TPR_14 TPR_12 TPR_17 TPR_9 TPR_19 TPR_16 TPR_7 DUF5569 MIT TPR_21 TPR_MalT RPN7 NRBF2_MIT YfiO
Other DBs
NCBI-GeneID: 9868
NCBI-ProteinID: NP_055635
OMIM: 606081
HGNC: 11985
Ensembl: ENSG00000154174
Vega: OTTHUMG00000159065
Pharos: O94826(Tbio)
UniProt: O94826
Position
3q12.2
AA seq 608 aa
MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWS
RQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNK
GNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAV
ELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKA
KEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLK
AKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKE
ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYA
LYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEI
DNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK
YGLKPPTL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggccgcctctaaacctgtggaggcagcggtggtcgcagccgctgtaccgagctccggg
agtggggtgggcggcggcgggactgcgggcccgggcacgggggggctgccgcgatggcag
ctggctctggcggtcggggcacccctgctgctgggcgcgggtgccatatacctgtggagt
cggcagcaacggcgccgggaggccagaggccggggcgacgccagcggcctgaagcgcaac
agcgaacggaagaccccggagggcagggccagtccggccccgggcagcggacaccctgaa
ggtcccggtgctcacttggacatgaactctcttgatagagcccaagcagccaagaataaa
ggcaataaatattttaaagcaggaaaatatgaacaagctattcagtgctatactgaggct
attagcttgtgccctacagagaagaatgttgacctttctacattttatcaaaacagagct
gctgcctttgaacagttgcaaaaatggaaagaagtggcacaagactgtacaaaagctgtt
gaacttaatcccaaatatgtgaaagctctctttagacgtgcaaaagcccatgagaagcta
gacaataagaaggaatgtttagaagatgtcactgctgtgtgtatattagaagggttccaa
aatcaacaaagcatgctgttagccgataaagttcttaaactccttggaaaagagaaagcc
aaagaaaaatataagaatcgtgaacctctgatgccatctccacagtttatcaaatcttac
ttcagttctttcacggatgatatcatttcccagcccatgcttaaaggagagaaatctgat
gaagataaagacaaggaaggggaggctttagaagtgaaagaaaattctggatacttaaag
gccaaacagtatatggaagaagaaaactacgataaaatcataagtgaatgctcaaaagaa
atagatgctgaaggcaaatacatggcagaagcattgctactacgagctaccttctacctg
cttattggcaatgccaatgcagccaaaccagatttagataaagtcatcagtttgaaagaa
gctaatgtgaagcttcgagcaaatgctctcatcaaaagaggcagcatgtacatgcaacag
cagcagcctttgctgtccactcaagattttaacatggctgctgacatcgatcctcagaat
gcagatgtttatcaccaccgaggacagctgaaaatactccttgatcaagttgaagaagca
gtggcagattttgatgaatgtattaggttaagacctgagtctgctctggcacaagcacag
aaatgttttgcattgtaccgccaggcatatacgggaaacaactcttcacaaatccaagca
gctatgaaaggttttgaagaggtcataaagaaatttccaaggtgtgccgaaggctatgca
ctatacgcccaggcattaacagatcaacaacagtttggtaaagctgatgaaatgtatgat
aaatgtattgatttggaaccagataatgctacaacatatgttcataaaggtttacttcaa
cttcagtggaagcaagatctggatagaggtttggaacttatcagcaaggctattgaaatt
gacaataaatgtgattttgcctatgaaaccatgggaactattgaagtacaaagaggaaac
atggagaaagccattgacatgttcaacaaagctattaacctggccaaatcggaaatggag
atggcccatctgtattcactttgcgatgccgcccatgcccagacagaagttgcaaagaaa
tacggattaaaaccaccaacattataa

KEGG   Homo sapiens (human): 3098
Entry
3098              CDS       T01001                                 

Gene name
HK1, HK, HK1-ta, HK1-tb, HK1-tc, HKD, HKI, HMSNR, HXK1, NEDVIBA, RP79, hexokinase
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa00524  Neomycin, kanamycin and gentamicin biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04066  HIF-1 signaling pathway
hsa04910  Insulin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04973  Carbohydrate digestion and absorption
hsa05131  Shigellosis
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
hsa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Network
nt06131  Apoptosis (viruses and bacteria)
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N00950  Shigella FimA to crosstalk between extrinsic and intrinsic apoptotic pathways
N01137  PINK-Parkin-mediated autophagosome formation
N01138  Mutation-inactivated OPTN to PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
Disease
H00527  Retinitis pigmentosa
H00664  Anemia due to disorders of glycolytic enzymes
H02470  Neurodevelopmental disorder with structural brain abnormalities
Drug target
Lonidamine: D07257
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3098 (HK1)
   00051 Fructose and mannose metabolism
    3098 (HK1)
   00052 Galactose metabolism
    3098 (HK1)
   00500 Starch and sucrose metabolism
    3098 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    3098 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    3098 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    3098 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    3098 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    3098 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3098 (HK1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3098 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    3098 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3098 (HK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     3098 (HK1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    3098 (HK1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD Sec23_helical
Other DBs
NCBI-GeneID: 3098
NCBI-ProteinID: NP_000179
OMIM: 142600
HGNC: 4922
Ensembl: ENSG00000156515
Vega: OTTHUMG00000018380
Pharos: P19367(Tbio)
UniProt: P19367 Q59FD4 A8K7J7 B3KXY9
Structure
PDB: 

Position
10q22.1
AA seq 917 aa
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRTEASS
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcacggagctgaaggatgaccaggtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaactctcatagatatcatg
actcgcttcaggaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacattcgtaaggtccattcctgatggctctgaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaagtgaatcatgag
aaaaaccagaatgttcacatggagtccgaggtttatgacaccccagagaacatcgtgcac
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggagaaa
aggaagatcaaggacaagaagttacctgtgggattcacgttttcttttccttgccaacaa
tccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaagcgagcggagtg
gaaggagcagatgtggtcaaactgcttaacaaagccatcaaaaagcgaggggactatgat
gccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacctgtggctatgac
gaccagcactgtgaagtcggcctgatcatcggcactggcaccaatgcttgctacatggag
gaactgaggcacattgatctggtggaaggagacgaggggaggatgtgtatcaatacagaa
tggggagcctttggagacgatggatcattagaagacatccggacagagtttgacagggag
atagaccggggatccctcaaccctggaaaacagctgtttgagaagatggtcagtggcatg
tacttgggagagctggttcgactgatcctagtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccggagctgctcacccgagggaagtttaacaccagtgatgtgtca
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtccgatgatgactgtgtctcagtccagcacgtttgcaccattgtctcattt
cgctcagccaacttggtggctgccacactgggcgccatcttgaaccgcctgcgtgataac
aagggcacacccaggctgcggaccacggttggtgtcgacggatctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctaaggcgcttggtgccagactccgatgtg
cgcttcctcctctcggagagtggcagcggcaagggggctgccatggtgacggcggtggcc
taccgcttggccgagcagcaccggcagatagaggagaccctggctcatttccacctcacc
aaggacatgctgctggaggtgaagaagaggatgcgggccgagatggagctggggctgagg
aagcagacgcacaacaatgccgtggttaagatgctgccctccttcgtccggagaactccc
gacgggaccgagaatggtgacttcttggccctggatcttggaggaaccaatttccgtgtg
ctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcacaacaagatctac
gccattcctattgaaatcatgcagggcactggggaagagctgtttgatcacattgtctcc
tgcatctctgacttcttggactacatggggatcaaaggccccaggatgcctctgggcttc
acgttctcatttccctgccagcagacgagtctggacgcgggaatcttgatcacgtggaca
aagggttttaaggcaacagactgcgtgggccacgatgtagtcaccttactaagggatgcg
ataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaacgacacagtgggc
accatgatgacctgtgcttatgaggagcccacctgtgaggttggactcattgttgggacc
ggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtggagggggaccag
gggcagatgtgcatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcaggacacactacgacagactggtggacgaatattccctaaatgctgggaaacaaagg
tatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaacatcttaatcgac
ttcaccaagaagggattcctcttccgagggcagatctctgagacgctgaagacccggggc
atctttgagaccaagtttctctctcagatcgagagtgaccgattagcactgctccaggtc
cgggctatcctccagcagctaggtctgaatagcacctgcgatgacagtatcctcgtcaag
acagtgtgcggggtggtgtccaggagggccgcacagctgtgtggcgcaggcatggctgcg
gttgtggataagatccgcgagaacagaggactggaccgtctgaatgtgactgtgggagtg
gacgggacactctacaagcttcatccacacttctccagaatcatgcaccagacggtgaag
gaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggcagcggcaagggg
gccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagcagctaa

DBGET integrated database retrieval system