KEGG   Homo sapiens (human): 55854Help
Entry
55854             CDS       T01001                                 

Gene name
ZC3H15, HT010, LEREPO4, MSTP012
Definition
(RefSeq) zinc finger CCCH-type containing 15
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DFRP_C zf-CCCH_4 zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_2
Motif
Other DBs
NCBI-GeneID: 55854
NCBI-ProteinID: NP_060941
HGNC: 29528
Ensembl: ENSG00000065548
Vega: OTTHUMG00000154251
Pharos: Q8WU90(Tbio)
UniProt: Q8WU90
Position
2q32.1
AA seq 426 aa AA seqDB search
MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQV
AQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCK
FSHDLTLERKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGEAEKKKPKTQIVC
KHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERER
SALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE
LVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIPRDVDETGITVASLERFSTYTS
DKDENKLSEASGGRAENGERSDLEEDNEREGTENGAIDAVPVDENLFTGEDLDELEEELN
TLDLEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaagaaacaggctcaggccgggggcagcaaaaaggcggagcaaaaaaagaag
gagaagattatcgaagacaaaactttcggtttgaagaataagaaaggagcaaagcaacag
aagtttatcaaggctgtcacacatcaagttaaatttggtcaacaaaatccacgtcaggta
gcacagagtgaagctgaaaagaaattgaagaaggatgacaagaagaaagaattgcaggag
ctaaatgagctgttcaaacctgtagttgctgctcaaaaaataagtaaaggtgcagatccc
aagtctgtagtatgtgcattcttcaagcaaggacagtgtactaaaggagataagtgtaag
ttctcccatgacttgactctggagagaaaatgtgaaaagcgaagtgtttacattgatgca
agagatgaagaacttgaaaaagatactatggataattgggatgagaaaaagctggaagaa
gtagtgaacaagaagcacggtgaggcggaaaagaaaaaaccaaaaactcaaatagtgtgc
aagcatttcctggaagctattgaaaacaacaagtatggctggttttgggtatgccctgga
gggggtgatatttgcatgtatcgtcatgcacttcctcctggatttgtgttgaaaaaagat
aaaaagaaagaagagaaagaagatgaaatttcattagaagatctaattgagagagagcgt
tctgccctaggtccaaatgttaccaaaatcactctagaatcttttcttgcctggaagaaa
aggaaaagacaagaaaagattgataaacttgaacaagatatggaaagaaggaaagctgac
ttcaaagcagggaaagcactagtgatcagtggtcgtgaagtgtttgaatttcgtcctgaa
ctggtcaatgatgatgatgaggaagcagatgatacccgctacacccagggaacaggtggt
gatgaggttgatgattcagtgagtgtaaatgacatagatttaagcctgtacatcccaaga
gatgtagatgaaacaggtattactgtagccagtcttgaaagattcagcacatatacttca
gataaagatgaaaacaaattaagtgaagcttctggaggtagggctgaaaatggtgaaaga
agtgacttggaagaggacaacgagagggagggaacggaaaatggagccattgatgctgtt
cctgttgatgaaaatcttttcactggagaggatttggatgaactagaagaagaattaaat
acacttgatttagaagaatga

DBGET integrated database retrieval system