KEGG   Homo sapiens (human): 55859
Entry
55859             CDS       T01001                                 
Symbol
BEX1, BEX2, HBEX2, HGR74-h
Name
(RefSeq) brain expressed X-linked 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BEX
Other DBs
NCBI-GeneID: 55859
NCBI-ProteinID: NP_060946
OMIM: 300690
HGNC: 1036
Ensembl: ENSG00000133169
Vega: OTTHUMG00000022708
Pharos: Q9HBH7(Tbio)
UniProt: Q9HBH7
Position
X:complement(103062651..103064171)
AA seq 125 aa
MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPIL
QYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDE
FCLMP
NT seq 378 nt   +upstreamnt  +downstreamnt
atggagtccaaagagaaacgagcagtaaacagtctcagcatggaaaatgccaaccaagaa
aatgaagaaaaggagcaagttgctaataaaggggagcccttggccctccctttggatgct
ggtgaatactgtgtgcctagaggaaatcgtaggcggttccgcgttaggcagcccatcctg
cagtatagatgggatatgatgcataggcttggagaaccacaggcaaggatgagagaagag
aatatggaaaggattggggaggaggtgagacagctgatggaaaagctgagggaaaagcag
ttgagtcatagtctgcgggcagtcagcactgacccccctcaccatgaccatcatgatgag
ttttgccttatgccctga

DBGET integrated database retrieval system