KEGG   Homo sapiens (human): 5587Help
Entry
5587              CDS       T01001                                 

Gene name
PRKD1, CHDED, PKC-MU, PKCM, PKD, PRKCM
Definition
(RefSeq) protein kinase D1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5587 (PRKD1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    5587 (PRKD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5587 (PRKD1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   5587 (PRKD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9 APH
Motif
Other DBs
NCBI-GeneID: 5587
NCBI-ProteinID: NP_002733
OMIM: 605435
HGNC: 9407
Ensembl: ENSG00000184304
Vega: OTTHUMG00000140203
Pharos: Q15139(Tchem)
UniProt: Q15139
Position
14q12
AA seq 912 aa AA seqDB search
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccctccggtcctgcggccgcccagtccgctgctgcccgtggcggcggcagct
gccgcagcggccgccgcactggtcccagggtccgggcccgggcccgcgccgttcttggct
cctgtcgcggccccggtcgggggcatctcgttccatctgcagatcggcctgagccgtgag
ccggtgctgctgctgcaggactcgtccggggactacagcctggcgcacgtccgcgagatg
gcttgctccattgtcgaccagaagttccctgaatgtggtttctacggaatgtatgataag
atcctgctttttcgccatgaccctacctctgaaaacatccttcagctggtgaaagcggcc
agtgatatccaggaaggcgatcttattgaagtggtcttgtcagcttccgccacctttgaa
gactttcagattcgtccccacgctctctttgttcattcatacagagctccagctttctgt
gatcactgtggagaaatgctgtgggggctggtacgtcaaggtcttaaatgtgaagggtgt
ggtctgaattaccataagagatgtgcatttaaaatacccaacaattgcagcggtgtgagg
cggagaaggctctcaaacgtttccctcactggggtcagcaccatccgcacatcatctgct
gaactctctacaagtgcccctgatgagccccttctgcaaaaatcaccatcagagtcgttt
attggtcgagagaagaggtcaaattctcaatcatacattggacgaccaattcaccttgac
aagattttgatgtctaaagttaaagtgccgcacacatttgtcatccactcctacacccgg
cccacagtgtgccagtactgcaagaagcttctgaaggggcttttcaggcagggcttgcag
tgcaaagattgcagattcaactgccataaacgttgtgcaccgaaagtaccaaacaactgc
cttggcgaagtgaccattaatggagatttgcttagccctggggcagagtctgatgtggtc
atggaagaagggagtgatgacaatgatagtgaaaggaacagtgggctcatggatgatatg
gaagaagcaatggtccaagatgcagagatggcaatggcagagtgccagaacgacagtggc
gagatgcaagatccagacccagaccacgaggacgccaacagaaccatcagtccatcaaca
agcaacaatatcccactcatgagggtagtgcagtctgtcaaacacacgaagaggaaaagc
agcacagtcatgaaagaaggatggatggtccactacaccagcaaggacacgctgcggaaa
cggcactattggagattggatagcaaatgtattaccctctttcagaatgacacaggaagc
aggtactacaaggaaattcctttatctgaaattttgtctctggaaccagtaaaaacttca
gctttaattcctaatggggccaatcctcattgtttcgaaatcactacggcaaatgtagtg
tattatgtgggagaaaatgtggtcaatccttccagcccatcaccaaataacagtgttctc
accagtggcgttggtgcagatgtggccaggatgtgggagatagccatccagcatgccctt
atgcccgtcattcccaagggctcctccgtgggtacaggaaccaacttgcacagagatatc
tctgtgagtatttcagtatcaaattgccagattcaagaaaatgtggacatcagcacagta
tatcagatttttcctgatgaagtactgggttctggacagtttggaattgtttatggagga
aaacatcgtaaaacaggaagagatgtagctattaaaatcattgacaaattacgatttcca
acaaaacaagaaagccagcttcgtaatgaggttgcaattctacagaaccttcatcaccct
ggtgttgtaaatttggagtgtatgtttgagacgcctgaaagagtgtttgttgttatggaa
aaactccatggagacatgctggaaatgatcttgtcaagtgaaaagggcaggttgccagag
cacataacgaagtttttaattactcagatactcgtggctttgcggcaccttcattttaaa
aatatcgttcactgtgacctcaaaccagaaaatgtgttgctagcctcagctgatcctttt
cctcaggtgaaactttgtgattttggttttgcccggatcattggagagaagtctttccgg
aggtcagtggtgggtacccccgcttacctggctcctgaggtcctaaggaacaagggctac
aatcgctctctagacatgtggtctgttggggtcatcatctatgtaagcctaagcggcaca
ttcccatttaatgaagatgaagacatacacgaccaaattcagaatgcagctttcatgtat
ccaccaaatccctggaaggaaatatctcatgaagccattgatcttatcaacaatttgctg
caagtaaaaatgagaaagcgctacagtgtggataagaccttgagccacccttggctacag
gactatcagacctggttagatttgcgagagctggaatgcaaaatcggggagcgctacatc
acccatgaaagtgatgacctgaggtgggagaagtatgcaggcgagcaggggctgcagtac
cccacacacctgatcaatccaagtgctagccacagtgacactcctgagactgaagaaaca
gaaatgaaagccctcggtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system