KEGG   Homo sapiens (human): 55871
Entry
55871             CDS       T01001                                 
Symbol
CBWD1, COBP, ZNG1A
Name
(RefSeq) COBW domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: cobW CobW_C RsgA_GTPase GTP_EFTU ABC_ATPase AAA_23 AAA_16 MMR_HSR1 ABC_tran TsaE AAA_22 AAA_18 AAA_29
Other DBs
NCBI-GeneID: 55871
NCBI-ProteinID: NP_060961
OMIM: 611078
HGNC: 17134
Ensembl: ENSG00000172785
Pharos: Q9BRT8(Tbio)
UniProt: Q9BRT8
Position
9:complement(120837..179056)
AA seq 395 aa
MLPAVGSADEEEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLN
YILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAI
ENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTE
EKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRTTIRSINGLGQILETQRSRVDLS
NVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWE
KNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNRLVLL
GRNLDKDILKQLFIATVTETEKQWTTRFQEDQVCT
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgttaccggctgttggatctgcggatgaggaggaggatcctgcggaggaggattgtcct
gaattggttcccattgagacgacgcaaagcgaggaggaggaaaagtctggcctcggcgcc
aagatcccagtcacaattatcaccgggtatttaggtgctgggaagacaacacttctgaac
tatattttgacagagcaacatagtaaaagagtagcggtcattttaaatgaatttggggaa
ggaagtgcgctggagaaatccttagctgtcagccaaggtggagagctctatgaagagtgg
ctggaacttagaaacggttgcctctgctgttcagtgaaggacagtggccttagagctatt
gagaatttgatgcaaaagaaggggaaatttgattacatactgttagagaccactggatta
gcagaccctggtgcagtggcttctatgttttgggttgatgctgaattagggagtgatatt
tatcttgatggtatcataactattgtggattcaaaatatggattaaaacatttaacagaa
gagaaacctgatggccttatcaatgaagctactagacaagttgctttggcagatgccatt
ctcattaataaaacagacctggttccagaagaagatgtaaagaaattaagaacgacaatt
agatccataaatggactaggacaaatcttagaaacacaaagatcaagagttgatctctct
aatgtattagatcttcatgcctttgatagtctctctggaataagtttgcagaaaaaactt
cagcatgtgccaggaacacaacctcaccttgatcagagtattgttacaatcacatttgaa
gtaccaggaaatgcaaaggaagaacatcttaatatgtttattcagaatctcctgtgggaa
aagaatgtgagaaacaaggacaatcactgcatggaggtcataaggctgaagggattggtg
tcaatcaaagacaaatcacaacaagtgattgtccagggtgtccatgagctctatgatctg
gaggagactccagtgagctggaaggatgacactgagagaacaaatcgattggtcctcctt
ggcagaaatttagataaggatatccttaaacagctgtttatagctactgtgacagaaaca
gaaaagcagtggacaacacgtttccaagaagatcaagtttgtacataa

DBGET integrated database retrieval system