KEGG   Homo sapiens (human): 55872Help
Entry
55872             CDS       T01001                                 

Gene name
PBK, CT84, HEL164, Nori-3, SPK, TOPK
Definition
(RefSeq) PDZ binding kinase
  KO
K08865  PDZ-binding kinase [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    55872 (PBK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     55872 (PBK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  TOPK family
   55872 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 55872
NCBI-ProteinID: NP_060962
OMIM: 611210
HGNC: 18282
Ensembl: ENSG00000168078
Vega: OTTHUMG00000102113
Pharos: Q96KB5(Tbio)
UniProt: Q96KB5 V9HWH0
Structure
PDB: 

Position
8p21.1
AA seq 322 aa AA seqDB search
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM
MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC
TNEDPKDRPSAAHIVEALETDV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatcagtaatttcaagacaccaagcaaattatcagaaaaaaagaaatctgta
ttatgttcaactccaactataaatatcccggcctctccgtttatgcagaagcttggcttt
ggtactggggtaaatgtgtacctaatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtaaaaaagattaatcctatatgtaatgatcattatcgaagtgtgtatcaaaag
agactaatggatgaagctaagattttgaaaagccttcatcatccaaacattgttggttat
cgtgcttttactgaagccaatgatggcagtctgtgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgatataaagccagccaagatccttttccagca
gccataattttaaaagttgctttgaatatggcaagagggttaaagtatctgcaccaagaa
aagaaactgcttcatggagacataaagtcttcaaatgttgtaattaaaggcgattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgtgact
gaccctgaggcttgttacattggcacagagccatggaaacccaaagaagctgtggaggag
aatggtgttattactgacaaggcagacatatttgcctttggccttactttgtgggaaatg
atgactttatcgattccacacattaatctttcaaatgatgatgatgatgaagataaaact
tttgatgaaagtgattttgatgatgaagcatactatgcagcgttgggaactaggccacct
attaatatggaagaactggatgaatcataccagaaagtaattgaactcttctctgtatgc
actaatgaagaccctaaagatcgtccttctgctgcacacattgttgaagctctggaaaca
gatgtctag

DBGET integrated database retrieval system