KEGG   Homo sapiens (human): 55876
Entry
55876             CDS       T01001                                 

Gene name
GSDMB, GSDMB-1, GSDML, PP4052, PRO2521
Definition
(RefSeq) gasdermin B
  KO
K22142  gasdermin-B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55876 (GSDMB)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   55876 (GSDMB)
SSDB
Motif
Pfam: Gasdermin Gasdermin_C
Other DBs
NCBI-GeneID: 55876
NCBI-ProteinID: NP_001159431
OMIM: 611221
HGNC: 23690
Ensembl: ENSG00000073605
Vega: OTTHUMG00000133248
Pharos: Q8TAX9(Tbio)
UniProt: Q8TAX9
Position
17q21.1
AA seq 407 aa
MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMD
ILDTDGDKWLDELDSGLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKI
SENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWS
QISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSE
DSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHME
DPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKS
VMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgttcagcgtatttgaggaaatcacaagaattgtagttaaggagatggatgctggaggg
gatatgattgccgttagaagccttgttgatgctgatagattccgctgcttccatctggtg
ggggagaagagaactttctttggatgccggcactacacaacaggcctcaccctgatggac
attctggacacagatggggacaagtggttagatgaactggattctgggctccaaggtcaa
aaggctgagtttcaaattctggataatgtagactcaacgggagagttgatagtgagatta
cccaaagaaataacaatttcaggcagtttccagggcttccaccatcagaaaatcaagata
tcggagaaccggatatcccagcagtatctggctacccttgaaaacaggaagctgaagagg
gaactacccttttcattccgatcaattaatacgagagaaaacctgtatctggtgacagaa
actctggagacggtaaaggaggaaaccctgaaaagcgaccggcaatataaattttggagc
cagatctctcagggccatctcagctataaacacaagggccaaagggaagtgaccatcccc
ccaaatcgggtcctgagctatcgagtaaagcagcttgtcttccccaacaaggagacgatg
aatattcatttcaggggcaaaacaaaatcctttccagaaggaaagtctttgggttcggag
gattccagaaacatgaaggagaagttggaggacatggagagtgtcctcaaggacctgaca
gaggagaagagaaaagatgtgctaaactccctcgctaagtgcctcggcaaggaggatatt
cggcaggatctagagcaaagagtatctgaggtcctgatttccggggagctacacatggag
gacccagacaagcctctcctaagcagcctttttaatgctgctggggtcttggtagaagcg
cgtgcaaaagccattctggacttcctggatgccctgctagagctgtctgaagagcagcag
tttgtggctgaggccctggagaaggggacccttcctctgttgaaggaccaggtgaaatct
gtcatggagcagaactgggatgagctggccagcagtcctcctgacatggactatgaccct
gaggcacgaattctctgtgcgctgtatgttgttgtctctatcctgctggagctggctgag
gggcctacctctgtctcttcctaa

DBGET integrated database retrieval system