KEGG   Homo sapiens (human): 5589Help
Entry
5589              CDS       T01001                                 

Gene name
PRKCSH, AGE-R2, G19P1, GIIB, PCLD, PCLD1, PKCSH, PLD1, VASAP-60
Definition
(RefSeq) protein kinase C substrate 80K-H
  KO
K08288  protein kinase C substrate 80K-H
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00545  Polycystic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5589 (PRKCSH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    5589 (PRKCSH)
Lectins [BR:hsa04091]
 P-type lectins
  5589 (PRKCSH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 EF-hand_6 EF-hand_1 Ldl_recept_a EF-hand_7 YjhX_toxin
Motif
Other DBs
NCBI-GeneID: 5589
NCBI-ProteinID: NP_002734
OMIM: 177060
HGNC: 9411
Ensembl: ENSG00000130175
Vega: OTTHUMG00000182029
Pharos: P14314(Tbio)
UniProt: P14314
Position
19p13.2
AA seq 528 aa AA seqDB search
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEEAPPPLSPPQPASPAEEDKMPPYD
EQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTT
NEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTT
VRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgccgctgctgctgctgctacccatgtgctgggccgtggaggtcaagaggccc
cggggcgtctccctcaccaatcatcacttctacgatgagtccaagcctttcacctgcctg
gacggttcggccaccatcccatttgatcaggtcaacgatgactattgcgactgcaaagat
ggctctgacgagccaggcacggctgcctgtcctaatggcagcttccactgcaccaacact
ggctataagcccctgtatatcccctccaaccgggtcaacgatggtgtttgtgactgctgc
gatggaacagacgagtacaacagcggcgtcatctgtgagaacacctgcaaagagaagggc
cgtaaggagagagagtccctgcagcagatggccgaggtcacccgcgaagggttccgtctg
aagaagatccttattgaggactggaagaaggcacgggaggagaagcagaaaaagctcatt
gagctacaggctgggaagaagtctctggaagaccaggtggagatgctgcggacagtgaag
gaggaagctgagaagccagagagagaggccaaagagcagcaccagaagctgtgggaagag
cagctggctgctgccaaggcccaacaggagcaggagctggcggctgatgccttcaaggag
ctggatgatgacatggacgggacggtctcggtgactgagctgcagactcacccggagctg
gacacagatggggatggggcgttgtcagaagcggaagctcaggccctcctcagtggggac
acacagacagacgccacctctttctacgaccgcgtctgggccgccatcagggacaagtac
cggtccgaggcactgcccaccgaccttccagcaccttctgcccctgacttgacggagccc
aaggaggagcagccgccagtgccctcgtcgcccacagaggaggaggaggaggaggaggag
gaggaggaagaagaggctgaagaagaggaggaggaggaggattccgaggaggccccaccg
ccactgtcacccccgcagccggccagccctgctgaggaagacaaaatgccgccctacgac
gagcagacgcaggccttcatcgatgctgcccaggaggcccgcaacaagttcgaggaggcc
gagcggtcgctgaaggacatggaggagtccatcaggaacctggagcaagagatttctttt
gactttggccccaacggggagtttgcttacctgtacagccagtgctacgagctcaccacc
aacgaatacgtctaccgcctctgccccttcaagcttgtctcgcagaaacccaaactcggg
ggctctcccaccagccttggcacctggggctcatggattggccccgaccacgacaagttc
agtgccatgaagtatgagcaaggcacgggctgctggcagggccccaaccgctccaccacc
gtgcgcctcctgtgcgggaaagagaccatggtgaccagcaccacagagcccagtcgctgc
gagtacctcatggagctgatgacgccagccgcctgcccggagccaccgcctgaagcaccc
accgaagacgaccatgacgagctctag

DBGET integrated database retrieval system