KEGG   Homo sapiens (human): 55890Help
Entry
55890             CDS       T01001                                 

Gene name
GPRC5C, RAIG-3, RAIG3
Definition
(RefSeq) G protein-coupled receptor class C group 5 member C
  KO
K04620  G protein-coupled receptor family C group 5 member C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    55890 (GPRC5C)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Orphan GPRC5
   55890 (GPRC5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 Bax1-I DUF4149
Motif
Other DBs
NCBI-GeneID: 55890
NCBI-ProteinID: NP_061123
OMIM: 605949
HGNC: 13309
Ensembl: ENSG00000170412
Vega: OTTHUMG00000067613
Pharos: Q9NQ84(Tdark)
UniProt: Q9NQ84 Q9BSP0 A0A024R8N9
Position
17q25.1
AA seq 441 aa AA seqDB search
MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAG
IVTTFVLTIILVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRR
FLFGVLFAICFSCLAAHVFALNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLV
RGSGEGGPQGNSSAGWAVASPCAIANMDFVMALIYVMLLLLGAFLGAWPALCGRYKRWRK
HGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTLAIALAANAWAFVLFYVIPEV
SQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSG
YNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ
AATPPKDGKNSQVFRNPYVWD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccatccacaaagccttggtgatgtgcctgggactgcctctcttcctgttcccaggg
gcctgggcccagggccatgtcccacccggctgcagccaaggcctcaaccccctgtactac
aacctgtgtgaccgctctggggcgtggggcatcgtcctggaggccgtggctggggcgggc
attgtcaccacgtttgtgctcaccatcatcctggtggccagcctcccctttgtgcaggac
accaagaaacggagcctgctggggacccaggtattcttccttctggggaccctgggcctc
ttctgcctcgtgtttgcctgtgtggtgaagcccgacttctccacctgtgcctctcggcgc
ttcctctttggggttctgttcgccatctgcttctcttgtctggcggctcacgtctttgcc
ctcaacttcctggcccggaagaaccacgggccccggggctgggtgatcttcactgtggct
ctgctgctgaccctggtagaggtcatcatcaatacagagtggctgatcatcaccctggtt
cggggcagtggcgagggcggccctcagggcaacagcagcgcaggctgggccgtggcctcc
ccctgtgccatcgccaacatggactttgtcatggcactcatctacgtcatgctgctgctg
ctgggtgccttcctgggggcctggcccgccctgtgtggccgctacaagcgctggcgtaag
catggggtctttgtgctcctcaccacagccacctccgttgccatatgggtggtgtggatc
gtcatgtatacttacggcaacaagcagcacaacagtcccacctgggatgaccccacgctg
gccatcgccctcgccgccaatgcctgggccttcgtcctcttctacgtcatccccgaggtc
tcccaggtgaccaagtccagcccagagcaaagctaccagggggacatgtaccccacccgg
ggcgtgggctatgagaccatcctgaaagagcagaagggtcagagcatgttcgtggagaac
aaggccttttccatggatgagccggttgcagctaagaggccggtgtcaccatacagcggg
tacaatgggcagctgctgaccagtgtgtaccagcccactgagatggccctgatgcacaaa
gttccgtccgaaggagcttacgacatcatcctcccacgggccaccgccaacagccaggtg
atgggcagtgccaactcgaccctgcgggctgaagacatgtactcggcccagagccaccag
gcggccacaccgccgaaagacggcaagaactctcaggtctttagaaacccctacgtgtgg
gactga

DBGET integrated database retrieval system