KEGG   Homo sapiens (human): 5590Help
Entry
5590              CDS       T01001                                 

Gene name
PRKCZ, PKC-ZETA, PKC2
Definition
(RefSeq) protein kinase C zeta
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04910  Insulin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05165  Human papillomavirus infection
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5590 (PRKCZ)
   04390 Hippo signaling pathway
    5590 (PRKCZ)
   04071 Sphingolipid signaling pathway
    5590 (PRKCZ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5590 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5590 (PRKCZ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5590 (PRKCZ)
   04062 Chemokine signaling pathway
    5590 (PRKCZ)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5590 (PRKCZ)
   04926 Relaxin signaling pathway
    5590 (PRKCZ)
  09158 Development
   04360 Axon guidance
    5590 (PRKCZ)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5590 (PRKCZ)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5590 (PRKCZ)
   04931 Insulin resistance
    5590 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5590 (PRKCZ)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    5590 (PRKCZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5590 (PRKCZ)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5590 (PRKCZ)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5590 (PRKCZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 C1_1 Pkinase_C Kinase-like C1_2 APH Haspin_kinase Kdo DZR
Motif
Other DBs
NCBI-GeneID: 5590
NCBI-ProteinID: NP_002735
OMIM: 176982
HGNC: 9412
Ensembl: ENSG00000067606
Vega: OTTHUMG00000001238
Pharos: Q05513(Tchem)
UniProt: Q05513
Position
1p36.33
AA seq 592 aa AA seqDB search
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaggaccggccccaagatggaagggagcggcggccgcgtccgcctcaaggcg
cattacgggggggacatcttcatcaccagcgtggacgccgccacgaccttcgaggagctc
tgtgaggaagtgagagacatgtgtcgtctgcaccagcagcacccgctcaccctcaagtgg
gtggacagcgaaggtgacccttgcacggtgtcctcccagatggagctggaagaggctttc
cgcctggcccgtcagtgcagggatgaaggcctcatcattcatgttttcccgagcacccct
gagcagcctggcctgccatgtccgggagaagacaaatctatctaccgccggggagccaga
agatggaggaagctgtaccgtgccaacggccacctcttccaagccaagcgctttaacagg
agagcgtactgcggtcagtgcagcgagaggatatggggcctcgcgaggcaaggctacagg
tgcatcaactgcaaactgctggtccataagcgctgccacggcctcgtcccgctgacctgc
aggaagcatatggattctgtcatgccttcccaagagcctccagtagacgacaagaacgag
gacgccgaccttccttccgaggagacagatggaattgcttacatttcctcatcccggaag
catgacagcattaaagacgactcggaggaccttaagccagttatcgatgggatggatgga
atcaaaatctctcaggggcttgggctgcaggactttgacctaatcagagtcatcgggcgc
gggagctacgccaaggttctcctggtgcggttgaagaagaatgaccaaatttacgccatg
aaagtggtgaagaaagagctggtgcatgatgacgaggatattgactgggtacagacagag
aagcacgtgtttgagcaggcatccagcaaccccttcctggtcggattacactcctgcttc
cagacgacaagtcggttgttcctggtcattgagtacgtcaacggcggggacctgatgttc
cacatgcagaggcagaggaagctccctgaggagcacgccaggttctacgcggccgagatc
tgcatcgccctcaacttcctgcacgagagggggatcatctacagggacctgaagctggac
aacgtcctcctggatgcggacgggcacatcaagctcacagactacggcatgtgcaaggaa
ggcctgggccctggtgacacaacgagcactttctgcggaaccccgaattacatcgccccc
gaaatcctgcggggagaggagtacgggttcagcgtggactggtgggcgctgggagtcctc
atgtttgagatgatggccgggcgctccccgttcgacatcatcaccgacaacccggacatg
aacacagaggactaccttttccaagtgatcctggagaagcccatccggatcccccggttc
ctgtccgtcaaagcctcccatgttttaaaaggatttttaaataaggaccccaaagagagg
ctcggctgccggccacagactggattttctgacatcaagtcccacgcgttcttccgcagc
atagactgggacttgctggagaagaagcaggcgctccctccattccagccacagatcaca
gacgactacggtctggacaactttgacacacagttcaccagcgagcccgtgcagctgacc
ccagacgatgaggatgccataaagaggatcgaccagtcagagttcgaaggctttgagtat
atcaacccattattgctgtccaccgaggagtcggtgtga

DBGET integrated database retrieval system