KEGG   Homo sapiens (human): 55901
Entry
55901             CDS       T01001                                 

Gene name
THSD1, ANIB12, TMTSP, UNQ3010
Definition
(RefSeq) thrombospondin type 1 domain containing 1
  KO
K24433  thrombospondin type-1 domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    55901 (THSD1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Thrombospondin domain-containing proteins
  Other thrombospondin domain-containing proteins
   55901 (THSD1)
SSDB
Motif
Pfam: TSP_1 TSP1_spondin TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 55901
NCBI-ProteinID: NP_061146
OMIM: 616821
HGNC: 17754
Ensembl: ENSG00000136114
Vega: OTTHUMG00000016963
Pharos: Q9NS62(Tbio)
UniProt: Q9NS62 A0A024R064 B3KTY7
Position
13q14.3
AA seq 852 aa
MKPMLKDFSNLLLVVLCDYVLGEAEYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVS
VLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKS
AFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARR
NSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKF
GYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERR
TIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTETWGLWQPWSQCSATCGDGV
RERRRVCLTSFPSSPVCPGMSLEASLCSLEECAAFQPSSPSPLQPQGPVKSNNIVTVTGI
SLCLFIIIATVLITLWRRFGRPAKCSTPARHNSIHSPSFRKNSDEENICELSEQRGSFSD
GGDGPTGSPGDTGIPLTYRRSGPVPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEM
KKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAG
ERPPSRLDLNVTQASCAISPSQTLIRKSQARHVGSRGGPSERSHARNAHFRRTASFHEAR
QARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRG
PLNPLPKSYTLGQPLRKPDLGDHQAGLVAGIERTEPHRARRGPSPSHKSVSRKQSSPISP
KDNYQRVSSLSPSQCRKDKCQSFPTHPEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEEDE
TTSTLSVEKLVI
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgaaaccaatgttgaaagacttttcaaatctattgttggtggtactctgtgactatgtt
cttggagaagctgaatatcttctcttgagagagccaggccatgtagcactaagcaacgac
acagtgtatgtggatttccagtattttgatggtgctaatgggacactgaggaatgtatct
gtcctgctgttggaggccaacaccaatcagactgtaactaccaagtacctcctgaccaac
cagtcccagggaacactaaagtttgagtgcttctatttcaaggaggctggtgactactgg
ttcacaatgactccagaagcaacagacaacagcactccattcccctggtgggagaaaagt
gcctttctgaaggtggaatggcctgtctttcacgttgacttgaataggagtgccaaggca
gcagaaggcaccttccaagtgggcctatttaccagtcaaccactgtgcccgtttcctgtg
gacaagcccaacatcgtagtggatgtcatcttcaccaacagtcttcctgaggcaagaaga
aattcaagacagccgctggaaataagaaccagcaaaaggacagaacttgctcaaggtcag
tgggttgagtttggctgtgcacccttggggccagaagcctatgtcaccgtggtgctgaag
ctgcttgggcgagactcagtcattacctccacaggacccattgacctggcccagaaattt
ggatacaaactggtgatggtgccagaactcacatgtgagtccggggtagaggtgacagtg
ctgcctccaccatgcaccttcgtccaaggagtggtcactgtcttcaaggaggcccccaga
taccctgggaagaggaccattcacttggctgaaaacagcctgcccctgggagagaggagg
acaatttttaactgtactttgtttgacatggggaagaataagtactgctttgactttggc
atttcaagcagaagccatttttctgcaaaggaggagtgcatgctaattcagagaaataca
gaaacttggggactgtggcagccatggagccagtgtagtgccacatgtggggatggtgtc
agagagcgtcgccgagtgtgtctcacttccttcccctccagtcctgtctgccctggaatg
tccttggaggcctccctgtgttccctggaggagtgtgctgctttccagccatccagccca
tctcctcttcagccccagggtccagtgaagtccaacaacatcgtgactgtcactggtata
tccttgtgcttgttcatcatcattgccactgtgctcatcacgctgtggaggaggttcggc
cggccagccaagtgcagcacacctgctcgacacaactccatccactcccccagcttccgg
aagaactcggacgaggagaatatctgcgagctgagcgagcagcgcgggagcttctcggat
gggggagacgggcccacggggagtccaggggacacaggcatccctctgacctacaggcgg
agcgggccggtacctcccgaggatgatgcctctggcagcgagagcttccagtccaacgcc
cagaagataatcccacctctgttcagctaccgccttgcccagcagcagttaaaggagatg
aaaaagaaaggtctgacggaaactaccaaagtgtatcacgtgtctcagagtcccctgaca
gacactgccattgatgcggcccccagcgctcccttagatttggaaagcccggaagaagct
gcagcaaacaagttccggatcaaatccccatttccggagcagcccgcggtcagtgccggg
gaaaggcctccctccaggctggatctaaatgtgactcaggccagttgtgccataagcccc
agccagactctgatccgcaagtcacaggcaaggcacgtgggcagcagagggggcccgtcc
gaaaggagccatgccaggaacgcccatttcaggaggacagcgagtttccatgaagccagg
caggcccggccgttccgagagaggagcatgtccactctgactccacggcaggcccctgcc
tacagctctaggacgcggacctgcgagcaggcagaggacagatttaggcctcagagtcga
ggtgcccacctgtttcctgaaaaactggagcatttccaagaggcaagtggaacccgtggt
ccattaaaccctctccctaaatcctacactttggggcagcccttgaggaaaccagacctt
ggggatcaccaggcaggattagtggccggaattgagagaacagagccccacagagctcgt
cggggaccgtcccccagtcacaagagtgtctcaaggaagcagtcttctcccatatccccc
aaagataactaccagagggtcagttctctgagcccttctcagtgtagaaaagacaagtgt
caaagcttccccactcaccctgagtttgccttctatgacaatacgtcgtttggcctcact
gaggctgagcagaggatgctggacctcccaggatattttgggtcaaatgaagaggatgaa
accacaagtacacttagcgtggagaagctggtgatctag

DBGET integrated database retrieval system