KEGG   Homo sapiens (human): 55909
Entry
55909             CDS       T01001                                 
Symbol
BIN3
Name
(RefSeq) bridging integrator 3
  KO
K20120  bridging integrator 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55909 (BIN3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    55909 (BIN3)
SSDB
Motif
Pfam: BAR Vps5 BAR_3 DUF4743 CENP-Q GCP_N_terminal DUF4665
Other DBs
NCBI-GeneID: 55909
NCBI-ProteinID: NP_061158
OMIM: 606396
HGNC: 1054
Ensembl: ENSG00000147439
Vega: OTTHUMG00000163844
Pharos: Q9NQY0(Tbio)
UniProt: Q9NQY0
Position
8:complement(22620418..22669121)
AA seq 253 aa
MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAV
KISLDLLSNPLCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPS
LNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLL
EEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAK
LSELRALSIVADD
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagctggattccttttaagattgggcagcccaagaaacagattgtgcccaaaacagtg
gagagagactttgaaagggagtatggaaaacttcagcagctggaagagcagacccggagg
ctgcagaaagacatgaagaagagcaccgacgcagacctggccatgtcaaaatctgccgtg
aagatatccttggacttactctccaatcccctctgtgagcaagaccaggaccttctgaac
atggtgacggccctggacacggccatgaagcggatggatgccttcaatcaggaaaaggtg
aaccagatccagaagactgtgatcgagcccttaaaaaagttcggcagtgtcttcccgagc
ctcaacatggctgtgaagaggcgggaacaggccttgcaggactacaggaggctgcaggcc
aaggtggagaagtatgaggaaaaggagaagacggggccagtgctggccaagctccaccag
gcacgagaggagctgcggcctgtgcgggaggactttgaagccaagaacaggcagctgctg
gaggagatgccgcgcttctacggcagccgcctcgactacttccagcccagctttgagtcc
ctcatccgagctcaggttgtgtactactcggaaatgcacaagatctttggagacctgtcc
catcagcttgaccagccaggccactccgatgagcagcgggagcgggagaacgaggccaaa
ctcagtgagctccgggccctctccattgtggccgatgactga

DBGET integrated database retrieval system