KEGG   Homo sapiens (human): 55914
Entry
55914             CDS       T01001                                 

Gene name
ERBIN, ERBB2IP, HEL-S-78, LAP2
Definition
(RefSeq) erbb2 interacting protein
  KO
K12796  erbb2-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    55914 (ERBIN)
SSDB
Motif
Pfam: LRR_8 LRR_4 PDZ PDZ_6 LRR_5 PDZ_2
Other DBs
NCBI-GeneID: 55914
NCBI-ProteinID: NP_001240626
OMIM: 606944
HGNC: 15842
Ensembl: ENSG00000112851
Vega: OTTHUMG00000097808
Pharos: Q96RT1(Tbio)
UniProt: Q96RT1
Structure
PDB: 

Position
5q12.3
AA seq 1412 aa
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEE
LPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIV
EASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTM
NRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKN
NIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLIS
VEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETL
PEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKM
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNL
KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTT
TVKSKVDEREKYMIGNSVQKISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEE
LSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSS
PSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDENFNSLLQNGDILNSSTEEKF
KAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKLITNDTFQPEI
MERSKTQDIVLGTSFLSINSKEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHD
SDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGGLKIYDILSDNGPQQPSTTVK
ITSAVDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRG
PTSGPQSAPQIYGPPQYNIQYSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQS
YAKHSANMNFSNHNNVRANTAYHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQRQSSV
SSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMMPGSQRPLSARTYSIDGPNAS
RPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQV
LRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQM
GQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQ
EIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANG
YSFINIEHGQAVSLLKTFQNTVELIIVREVSS
NT seq 4239 nt   +upstreamnt  +downstreamnt
atgactacaaaacgaagtttgtttgtgcggttggtaccatgtcgctgtctacgaggggaa
gaggagactgtcactactcttgattattctcattgcagcttagaacaagttccgaaagag
atttttacttttgaaaaaaccttggaggaactctatttagatgctaatcagattgaagag
cttccaaagcaactttttaactgtcagtctttacacaaactgagtttgccagacaatgat
ttaacaacgttaccagcatccattgcaaaccttattaatctcagggaactggatgtcagc
aagaatggaatacaggagtttccagaaaatataaaaaattgtaaagttttgacaattgtg
gaggccagtgtaaaccctatttccaagctccctgatggattttctcagctgttaaaccta
acccagttgtatctgaatgatgcttttcttgagttcttgccagcaaattttggcagatta
actaaactccaaatattagagcttagagaaaaccagttaaaaatgttgcctaaaactatg
aatagactgacccagctggaaagactggatttgggaagtaacgaattcacggaagtgcct
gaagtacttgagcaactaagtggattgaaagagttttggatggatgctaatagactgact
tttattccagggtttattggtagtttgaaacagctcacatatttggatgtttctaaaaat
aatattgaaatggttgaagaaggaatttcaacatgtgaaaaccttcaagacctcctatta
tcaagcaattcacttcagcagcttcctgagactattggttcgttgaagaatataacaacg
cttaaaatagatgaaaaccagttaatgtatctgccagactctataggagggttaatatca
gtagaagaactggattgtagtttcaatgaagttgaagctttgccttcatctattgggcag
cttactaacttaagaacttttgctgctgatcataattacttacagcagttgcccccagag
attggaagctggaaaaatataactgtgctgtttctccattccaataaacttgagacactt
ccagaggaaatgggtgatatgcaaaaattaaaagtcattaatttaagtgataatagatta
aagaatttaccctttagctttacaaagctacagcaattgacagctatgtggctctcagat
aatcagtccaaacccctgatacctcttcaaaaagaaactgattcagagacccagaaaatg
gtgcttaccaactacatgttccctcaacagccaaggactgaggatgttatgtttatatca
gataatgaaagttttaacccttcattgtgggaggaacagaggaaacagcgggctcaagtt
gcatttgaatgtgatgaagacaaagatgaaagggaggcacctcccagggagggaaattta
aaaagatatccaacaccatacccagatgagcttaagaatatggtcaaaactgttcaaacc
attgtacatagattaaaagatgaagagaccaatgaagactcaggaagagatttgaaacca
catgaagatcaacaagatataaataaagatgtgggtgtgaagacctcagaaagtactact
acagtaaaaagcaaagttgatgaaagagaaaaatatatgataggaaactctgtacagaag
atcagtgaacctgaagctgagattagtcctgggagtttaccagtgactgcaaatatgaaa
gcctctgagaacttgaagcatattgttaaccatgatgatgtttttgaggaatctgaagaa
ctttcttctgatgaagagatgaaaatggcggagatgcgaccaccattaattgaaacctct
attaaccagccaaaagtcgtagcacttagtaataacaaaaaagatgatacaaaggaaaca
gattctttatcagatgaagttacacacaatagcaatcagaataacagcaattgttcttct
ccatctcggatgtctgattcagtttctcttaatactgatagtagtcaagacacctcactc
tgctctccagtgaaacaaactcatattgatattaattccaaaatcaggcaagaagatgaa
aattttaacagccttttacaaaatggagatattttaaacagttcaacagaggaaaagttc
aaagctcatgataaaaaagattttaacttacctgaatatgatttgaatgttgaagagcga
ttagttctaattgagaaaagtgttgactcaacagccacagctgatgacactcacaaatta
gatcatatcaatatgaatcttaataaacttataactaatgatacatttcaaccagagatc
atggaaagatcaaaaacacaggatattgtgcttggaacaagctttttaagcattaattct
aaagaggaaactgagcacttggaaaatggaaacaagtatcctaatttggaatccgtaaat
aaggtaaatggacattctgaggaaacttcccagtctcctaataggactgaaccacatgac
agtgattgttctgttgacttaggtatttccaaaagcactgaagatctctcccctcagaaa
agtggtccagttggatctgttgtgaaatctcatagcataactaatatggagattggaggg
ctaaaaatctatgatattcttagtgataatggacctcagcagccaagtacaaccgttaaa
atcacatctgctgttgatggaaaaaatatagtcaggagcaagtctgccacactgttgtat
gatcaaccattgcaggtatttactggttcttcctcatcttctgatttaatatcaggaaca
aaggcaattttcaagtttgattcaaatcataatcccgaagagccaaatataataagaggc
cccacaagtggcccacaatctgcacctcaaatatatggtcctccacagtataatatccaa
tacagtagcagtgctgcagtcaaagacactttgtggcactccaaacaaaatccccaaata
gaccatgccagttttcctcctcagctccttcctagatcagagagcacagaaaatcaaagt
tatgctaaacattctgccaatatgaatttctctaatcataacaatgttcgagctaatact
gcataccatttacatcagagacttggcccagcaagacatggggaaatgtgggccatctca
ccaaacgaccgacttattcctgcagtaactcgaagtacaatccagcgacaaagtagtgtg
tcctccacagcctctgtaaatcttggtgatccaggctctacaaggcgggctcagattcct
gaaggagattatttatcatacagagagttccactcagcgggaagaactcctccaatgatg
ccaggatcacagagacccctttctgcacgaacatacagcatagatggtccaaatgcatca
agacctcagagtgctcgaccctctattaatgaaataccagagagaactatgtcagttagt
gatttcaattattcacggactagtccttcaaaaagaccaaatgcaagggttggttctgag
cattctttattagatcctccaggaaaaagtaaagttcctcgtgactggagagaacaagta
cttcgacatattgaagccaaaaagttagaaaagaagcatccccagacatccagttcagga
gatccttgtcaagatggtatattcatttcaggacagcagaactactcatcagccacactt
agtcacaaagatgttcctccagacagcttgatgaaaatgcctttgagtaatggacagatg
ggccagcctctcaggcctcaggcaaattatagtcaaatacatcacccccctcaggcatct
gtggcaaggcatccctctagagaacaactaattgattacttgatgctgaaagtggcccac
cagcctccatatacacagccccattgttctcctagacaaggccatgaactggcaaaacaa
gagattcgagtgagggttgaaaaggatccagaacttggatttagcatatcaggtggtgtc
gggggtagaggaaacccattcagacctgatgatgatggtatatttgtaacaagggtacaa
cctgaaggaccagcatcaaaattactgcagccaggtgataaaattattcaggctaatggc
tacagttttataaatattgaacatggacaagcagtgtccttgctaaaaactttccagaat
acagttgaactcatcattgtacgagaagtttcctcataa

DBGET integrated database retrieval system