KEGG   Homo sapiens (human): 55924
Entry
55924             CDS       T01001                                 
Symbol
INKA2, C1orf183, FAM212B
Name
(RefSeq) inka box actin regulator 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM212
Other DBs
NCBI-GeneID: 55924
NCBI-ProteinID: NP_061972
HGNC: 28045
Ensembl: ENSG00000197852
Pharos: Q9NTI7(Tdark)
UniProt: Q9NTI7
Position
1:complement(111722064..111755797)
AA seq 297 aa
MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGG
GPVPGSPEGPRTQCEHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLP
RTQPHQSCAQQGPERVEPDDWTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGE
KGETGGAREPKGEKGQPQELGRRFALTANIFKKFLRSVRPDRDRLLKEKPGWVTPMVPES
RTGRSQKVKKRSLSKGSGHFPFPGTGEHRRGENPPTSCPKALEHSPSGFDINTAVWV
NT seq 894 nt   +upstreamnt  +downstreamnt
atgacgatggagagcagggaaatggactgctatctccgtcgcctcaaacaggagctgatg
tccatgaaggaggtgggtgatggcttacaggatcagatgaactgcatgatgggtgcactg
caagaactgaagctcctccaggtgcagacagcactggaacagctggagatctctggaggg
ggtcctgtgccaggcagccctgaaggtcccaggacccagtgcgagcacccttgttgggag
ggtggcagaggtcctgccaggcccacagtctgttccccctccagtcaaccttctcttggc
agcagcaccaagtttccatcccataggagtgtctgtggaagggatttagcccccttgccc
aggacacagccacatcaaagctgtgctcagcaggggccagagcgagtggaaccggatgac
tggacctccacgttgatgtcccggggccggaatcgacagcctctggtgttaggggacaac
gtttttgcagacctggtgggcaattggctagacttgccagaactggagaagggtggggag
aagggtgagactgggggggcacgtgaacccaaaggagagaaaggccagccccaggagctg
ggccgcaggttcgccctgacagcaaacatctttaagaagttcttgcgtagtgtgcggcct
gaccgtgaccggctgctgaaggagaagccaggctgggtgacacccatggtccctgagtcc
cgaaccggccgctcacagaaggtcaagaagcggagcctttccaagggctctggacatttc
cccttcccaggcaccggggagcacaggcgaggggagaatccccccacaagctgccccaag
gccctggagcactcaccctcaggatttgatattaacacagctgtttgggtctga

DBGET integrated database retrieval system