KEGG   Homo sapiens (human): 55937
Entry
55937             CDS       T01001                                 
Symbol
APOM, G3a, HSPC336, NG20, apo-M
Name
(RefSeq) apolipoprotein M
  KO
K25354  apolipoprotein M
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    55937 (APOM)
SSDB
Motif
Pfam: ApoM Lipocalin
Other DBs
NCBI-GeneID: 55937
NCBI-ProteinID: NP_061974
OMIM: 606907
HGNC: 13916
Ensembl: ENSG00000204444
Pharos: O95445(Tbio)
UniProt: O95445
Structure
Position
6:31652404..31658210
AA seq 188 aa
MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEEL
ATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMK
TELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQ
EACELSNN
NT seq 567 nt   +upstreamnt  +downstreamnt
atgttccaccaaatttgggcagctctgctctacttctatggtattatccttaactccatc
taccagtgccctgagcacagtcaactgacaactctgggcgtggatgggaaggagttccca
gaggtccacttgggccagtggtactttatcgcaggggcagctcccaccaaggaggagttg
gcaacttttgaccctgtggacaacattgtcttcaatatggctgctggctctgccccgatg
cagctccaccttcgtgctaccatccgcatgaaagatgggctctgtgtgccccggaaatgg
atctaccacctgactgaagggagcacagatctcagaactgaaggccgccctgacatgaag
actgagctcttttccagctcatgcccaggtggaatcatgctgaatgagacaggccagggt
taccagcgctttctcctctacaatcgctcaccacatcctcccgaaaagtgtgtggaggaa
ttcaagtccctgacttcctgcctggactccaaagccttcttattgactcctaggaatcaa
gaggcctgtgagctgtccaataactga

DBGET integrated database retrieval system