KEGG   Homo sapiens (human): 55964Help
Entry
55964             CDS       T01001                                 

Gene name
SEPTIN3, SEP3, SEPT3, bK250D10.3
Definition
(RefSeq) septin 3
  KO
K16938  septin 3/9/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55964 (SEPTIN3)
   05100 Bacterial invasion of epithelial cells
    55964 (SEPTIN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55964 (SEPTIN3)
   04147 Exosome [BR:hsa04147]
    55964 (SEPTIN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     55964 (SEPTIN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55964 (SEPTIN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AIG1 Roc Dynamin_N AAA_16 AAA_22 ABC_tran Ras FtsK_SpoIIIE NB-ARC AAA_24 AAA_29 G-alpha Sigma54_activat FeoB_N AAA_32 IIGP AAA_7 DUF815
Motif
Other DBs
NCBI-GeneID: 55964
NCBI-ProteinID: NP_663786
OMIM: 608314
HGNC: 10750
Ensembl: ENSG00000100167
Vega: OTTHUMG00000030494
Pharos: Q9UH03(Tbio)
UniProt: Q9UH03
Structure
PDB: 

Position
22q13.2
AA seq 358 aa AA seqDB search
MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGF
DFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMK
LTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISP
TGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKE
FDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALL
RDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagggctcccagagaccaggacggacgcagccatgtcagagctggtgcctgag
cccaggcctaagccagcggtgcccatgaagcccatgagcatcaactccaacctgctgggc
tacatcggcatcgacaccatcatcgagcagatgcgcaagaagaccatgaagaccggtttc
gacttcaacatcatggtcgttggccagagtggactgggcaaatcaacgctggtcaacacg
ctcttcaaatcccaagtgagccgcaaggcctccagctggaaccgggaggagaagatcccc
aagacagtggagatcaaagctatcgggcatgtgatagaggaaggcggtgtcaaaatgaag
ctgaccgtcatcgacaccccaggctttggagaccaaatcaacaatgaaaactgctgggag
cccattgagaagtacatcaatgagcagtacgagaagttcctgaaggaggaggtcaacatc
gccaggaagaaacgcatccctgacactcgtgtccactgctgcctttacttcatctctccc
acaggacactccttgcgacctctggatcttgagttcatgaaacacctcagcaaggttgtg
aacatcatccctgtcattgctaaggctgacaccatgaccctggaggagaagtctgaattc
aagcaaagggttcgcaaggagcttgaagtaaatggcattgaattctacccccagaaggaa
tttgatgaggatttggaggataagacggagaatgacaaaatcaggcaggagagcatgcct
tttgctgtggtgggaagtgacaaggagtaccaagtgaatggcaagagggtcctcggccga
aaaactccatgggggatcatcgaagtggaaaacctcaaccactgtgagtttgccctgctt
cgagactttgtcatcaggacccacctccaggacctcaaggaagtgacacacaacatccac
tatgagacttacagggccaagcggctcaatgacaatggaggcctccctccgggagaaggc
ctcctgggcactgtccttccacctgtgccagccaccccctgccccactgctgaatga

DBGET integrated database retrieval system