KEGG   Homo sapiens (human): 55973Help
Entry
55973             CDS       T01001                                 

Gene name
BCAP29, BAP29
Definition
(RefSeq) B cell receptor associated protein 29
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Bap31 Bap31_Bap29_C GAS PolyA_pol_arg_C DUF1640 DUF3611 Syntaxin_2 APG6_N KASH_CCD
Motif
Other DBs
NCBI-GeneID: 55973
NCBI-ProteinID: NP_061332
HGNC: 24131
Ensembl: ENSG00000075790
Vega: OTTHUMG00000154770
Pharos: Q9UHQ4(Tbio)
UniProt: Q9UHQ4 E9PAJ1
Structure
PDB: 

Position
7q22.3
AA seq 241 aa AA seqDB search
MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI
VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL
VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL
VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacactccaatgggctgcagtggcaacctttctttatgccgaaataggactcatttta
atcttctgcctaccttttattcctcctcagagatggcagaagattttttcatttaatgtc
tggggtaaaattgcaactttttggaacaaggctttccttaccattatcatcctattgatt
gttctatttctagatgctgtgagagaagtaaggaaatattcctcagttcataccattgag
aagagctccaccagcagacctgatgcctatgaacacacacagatgaaactttttaggtct
caaagaaatctttacatttctggattttccctatttttttggctagttttgagacgtctg
gttacgcttattactcaactggcaaaagaactgtcaaacaaaggtgtacttaaaactcaa
gcagaaaatactaacaaggctgccaaaaaatttatggaagaaaacgaaaaactaaaaagg
attttgaaaagccatggtaaagatgaagaatgtgttttggaagcagaaaataaaaaacta
gtagaagaccaggagaaactgaaaactgaattaaggaagacttcagatgccctttctaag
gcacaaaatgatgtgatggaaatgaagatgcagtcagagagactttcgaaagaatatgat
caactcctgaaagaacactctgaacttcaggatcgtttagaaagaggcaacaagaaaaga
ctgtga

DBGET integrated database retrieval system