KEGG   Homo sapiens (human): 55974Help
Entry
55974             CDS       T01001                                 

Gene name
SLC50A1, HsSWEET1, RAG1AP1, SCP, SWEET1, slv
Definition
(RefSeq) solute carrier family 50 member 1
  KO
K15382  solute carrier family 50 (sugar transporter)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55974 (SLC50A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC50: Sugar efflux transporter
   55974 (SLC50A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MtN3_slv
Motif
Other DBs
NCBI-GeneID: 55974
NCBI-ProteinID: NP_061333
OMIM: 613683
HGNC: 30657
Ensembl: ENSG00000169241
Vega: OTTHUMG00000035333
Pharos: Q9BRV3(Tdark)
UniProt: Q9BRV3
Position
1q22
AA seq 221 aa AA seqDB search
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY
GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP
NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGF
RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgggcggctttctggactcgctcatttacggagcatgcgtggtcttcaccctt
ggcatgttctccgccggcctctcggacctcaggcacatgcgaatgacccggagtgtggac
aacgtccagttcctgccctttctcaccacggaagtcaacaacctgggctggctgagttat
ggggctttgaagggagacgggatcctcatcgtcgtcaacacagtgggtgctgcgcttcag
accctgtatatcttggcatatctgcattactgccctcggaagcgtgttgtgctcctacag
actgcaaccctgctaggggtccttctcctgggttatggctacttttggctcctggtaccc
aaccctgaggcccggcttcagcagttgggcctcttctgcagtgtcttcaccatcagcatg
tacctctcaccactggctgacttggctaaggtgattcaaactaaatcaacccaatgtctc
tcctacccactcaccattgctacccttctcacctctgcctcctggtgcctctatgggttt
cgactcagagatccctatatcatggtgtccaactttccaggaatcgtcaccagctttatc
cgcttctggcttttctggaagtacccccaggagcaagacaggaactactggctcctgcaa
acctga

DBGET integrated database retrieval system