KEGG   Homo sapiens (human): 5600Help
Entry
5600              CDS       T01001                                 

Gene name
MAPK11, P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00689  MAPK (p38) signaling
Network
nt06121  TLR signaling (virus)
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5600 (MAPK11)
   04010 MAPK signaling pathway
    5600 (MAPK11)
   04370 VEGF signaling pathway
    5600 (MAPK11)
   04668 TNF signaling pathway
    5600 (MAPK11)
   04068 FoxO signaling pathway
    5600 (MAPK11)
   04071 Sphingolipid signaling pathway
    5600 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5600 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5600 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5600 (MAPK11)
   04620 Toll-like receptor signaling pathway
    5600 (MAPK11)
   04621 NOD-like receptor signaling pathway
    5600 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    5600 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    5600 (MAPK11)
   04660 T cell receptor signaling pathway
    5600 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    5600 (MAPK11)
   04659 Th17 cell differentiation
    5600 (MAPK11)
   04657 IL-17 signaling pathway
    5600 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    5600 (MAPK11)
   04670 Leukocyte transendothelial migration
    5600 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5600 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    5600 (MAPK11)
   04917 Prolactin signaling pathway
    5600 (MAPK11)
   04926 Relaxin signaling pathway
    5600 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5600 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    5600 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    5600 (MAPK11)
   04722 Neurotrophin signaling pathway
    5600 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5600 (MAPK11)
  09158 Development
   04380 Osteoclast differentiation
    5600 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    5600 (MAPK11)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    5600 (MAPK11)
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5600 (MAPK11)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5600 (MAPK11)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5600 (MAPK11)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5600 (MAPK11)
   05132 Salmonella infection
    5600 (MAPK11)
   05131 Shigellosis
    5600 (MAPK11)
   05133 Pertussis
    5600 (MAPK11)
   05152 Tuberculosis
    5600 (MAPK11)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5600 (MAPK11)
   05161 Hepatitis B
    5600 (MAPK11)
   05163 Human cytomegalovirus infection
    5600 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5600 (MAPK11)
   05169 Epstein-Barr virus infection
    5600 (MAPK11)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    5600 (MAPK11)
   05140 Leishmaniasis
    5600 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    5600 (MAPK11)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    5600 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5600 (MAPK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5600 (MAPK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5600 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5600
NCBI-ProteinID: NP_002742
OMIM: 602898
HGNC: 6873
Ensembl: ENSG00000185386
Vega: OTTHUMG00000150226
Pharos: Q15759(Tchem)
UniProt: Q15759
Structure
PDB: 

Position
22q13.33
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggattttgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcagct
gaggcactggcccacgcctacttcagccagtaccacgaccccgaggatgagccagaggcc
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

DBGET integrated database retrieval system