KEGG   Homo sapiens (human): 5602Help
Entry
5602              CDS       T01001                                 

Gene name
MAPK10, JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00930  Escherichia NleD to TNF-JNK signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5602 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5602 (MAPK10)
   04010 MAPK signaling pathway
    5602 (MAPK10)
   04012 ErbB signaling pathway
    5602 (MAPK10)
   04310 Wnt signaling pathway
    5602 (MAPK10)
   04668 TNF signaling pathway
    5602 (MAPK10)
   04068 FoxO signaling pathway
    5602 (MAPK10)
   04071 Sphingolipid signaling pathway
    5602 (MAPK10)
   04024 cAMP signaling pathway
    5602 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5602 (MAPK10)
   04137 Mitophagy - animal
    5602 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    5602 (MAPK10)
   04215 Apoptosis - multiple species
    5602 (MAPK10)
   04217 Necroptosis
    5602 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5602 (MAPK10)
   04530 Tight junction
    5602 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5602 (MAPK10)
   04621 NOD-like receptor signaling pathway
    5602 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    5602 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    5602 (MAPK10)
   04660 T cell receptor signaling pathway
    5602 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    5602 (MAPK10)
   04659 Th17 cell differentiation
    5602 (MAPK10)
   04657 IL-17 signaling pathway
    5602 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    5602 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5602 (MAPK10)
   04920 Adipocytokine signaling pathway
    5602 (MAPK10)
   04912 GnRH signaling pathway
    5602 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    5602 (MAPK10)
   04917 Prolactin signaling pathway
    5602 (MAPK10)
   04926 Relaxin signaling pathway
    5602 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    5602 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    5602 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    5602 (MAPK10)
   04722 Neurotrophin signaling pathway
    5602 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5602 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5602 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5602 (MAPK10)
   05231 Choline metabolism in cancer
    5602 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5602 (MAPK10)
   05212 Pancreatic cancer
    5602 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5602 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5602 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5602 (MAPK10)
   04931 Insulin resistance
    5602 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5602 (MAPK10)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5602 (MAPK10)
   05130 Pathogenic Escherichia coli infection
    5602 (MAPK10)
   05132 Salmonella infection
    5602 (MAPK10)
   05131 Shigellosis
    5602 (MAPK10)
   05135 Yersinia infection
    5602 (MAPK10)
   05133 Pertussis
    5602 (MAPK10)
   05152 Tuberculosis
    5602 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5602 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    5602 (MAPK10)
   05162 Measles
    5602 (MAPK10)
   05161 Hepatitis B
    5602 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5602 (MAPK10)
   05169 Epstein-Barr virus infection
    5602 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5602 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    5602 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5602 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5602 (MAPK10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5602 (MAPK10)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5602 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5602
NCBI-ProteinID: NP_001304996
OMIM: 602897
HGNC: 6872
Ensembl: ENSG00000109339
Vega: OTTHUMG00000130604
Pharos: P53779(Tchem)
UniProt: P53779 A0A286YF97
Structure
PDB: 

Position
4q21.3
AA seq 464 aa AA seqDB search
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaagcacctc
cattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatgggctac
aaggagaacgttgacatgtggtcagtagggtgcatcatgggagaaatgataaaaggtgca
gtgctgtttcctggcactgatcatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system