KEGG   Homo sapiens (human): 56034Help
Entry
56034             CDS       T01001                                 

Gene name
PDGFC, FALLOTEIN, SCDGF
Definition
(RefSeq) platelet derived growth factor C
  KO
K05450  platelet derived growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04810  Regulation of actin cytoskeleton
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    56034 (PDGFC)
   04015 Rap1 signaling pathway
    56034 (PDGFC)
   04010 MAPK signaling pathway
    56034 (PDGFC)
   04072 Phospholipase D signaling pathway
    56034 (PDGFC)
   04151 PI3K-Akt signaling pathway
    56034 (PDGFC)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    56034 (PDGFC)
   04540 Gap junction
    56034 (PDGFC)
  Cell motility
   04810 Regulation of actin cytoskeleton
    56034 (PDGFC)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    56034 (PDGFC)
   05218 Melanoma
    56034 (PDGFC)
   05215 Prostate cancer
    56034 (PDGFC)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    56034 (PDGFC)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   56034 (PDGFC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUB PDGF
Motif
Other DBs
NCBI-GeneID: 56034
NCBI-ProteinID: NP_057289
OMIM: 608452
HGNC: 8801
Ensembl: ENSG00000145431
Vega: OTTHUMG00000161803
Pharos: Q9NRA1(Tbio)
UniProt: Q9NRA1
Position
4q32.1
AA seq 345 aa AA seqDB search
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcttcgggcttctcctgctgacatctgccctggccggccagagacaggggact
caggcggaatccaacctgagtagtaaattccagttttccagcaacaaggaacagaacgga
gtacaagatcctcagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaaggtttcctcatacttatccaagaaatacggtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacgtttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaactatatta
gggcgctggtgtggttctggtactgtaccaggaaaacagatttctaaaggaaatcaaatt
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgctacccccttcagct
ttgccactggacctgcttaataatgctataactgcctttagtaccttggaagaccttatt
cgatatcttgaaccagagagatggcagttggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggatctgaacctt
ctaacagaggaggtaagattatacagctgcacacctcgtaacttctcagtgtccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtgggaactgtgcctgttgtctccacaattgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaataccacgaggtccttcagttgagaccaaagaccggtgtcaggggattg
cacaaatcactcaccgacgtggccctggagcaccatgaggagtgtgactgtgtgtgcaga
gggagcacaggaggatag

DBGET integrated database retrieval system