KEGG   Homo sapiens (human): 5606Help
Entry
5606              CDS       T01001                                 

Gene name
MAP2K3, MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05145  Toxoplasmosis
hsa05164  Influenza A
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Module
hsa_M00689  MAPK (p38) signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00444  TNF-p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5606 (MAP2K3)
   04010 MAPK signaling pathway
    5606 (MAP2K3)
   04668 TNF signaling pathway
    5606 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5606 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5606 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    5606 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5606 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5606 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    5606 (MAP2K3)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5606 (MAP2K3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5606 (MAP2K3)
   05164 Influenza A
    5606 (MAP2K3)
   05169 Epstein-Barr virus infection
    5606 (MAP2K3)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    5606 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5606 (MAP2K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5606 (MAP2K3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   5606 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase RIO1 DUF4344
Motif
Other DBs
NCBI-GeneID: 5606
NCBI-ProteinID: NP_659731
OMIM: 602315
HGNC: 6843
Ensembl: ENSG00000034152
Vega: OTTHUMG00000134322
Pharos: P46734(Tchem)
UniProt: P46734 Q6FI23
Position
17p11.2
AA seq 347 aa AA seqDB search
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgcctcgagccagcccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctacggatatcctgcatgtccaagccacccgcacccaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gctgatgacttggtgaccatctcagaactgggccgtggagcctatggggtggtagagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcggatccgggccaccgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgactgt
ttctacactgtcaccttctacggggcactattcagagagggagacgtgtggatctgcatg
gagctcatggacacatccttggacaagttctaccggaaggtgctggataaaaacatgaca
attccagaggacatccttggggagattgctgtgtctatcgtgcgggccctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtccttatcaacaag
gagggccatgtgaagatgtgtgactttggcatcagtggctacttggtggactctgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccagagctg
aaccagaagggctacaatgtcaagtccgacgtctggagcctgggcatcaccatgattgag
atggccatcctgcggttcccttacgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccccagctcccagccgaccgtttctcccccgagtttgtggac
ttcactgctcagtgcctgaggaagaaccccgcagagcgtatgagctacctggagctgatg
gagcaccccttcttcaccttgcacaaaaccaagaagacggacattgctgccttcgtgaag
gagatcctgggagaagactcatag

DBGET integrated database retrieval system