KEGG   Homo sapiens (human): 5607Help
Entry
5607              CDS       T01001                                 

Gene name
MAP2K5, HsT17454, MAPKK5, MEK5, PRKMK5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04540  Gap junction
hsa04722  Neurotrophin signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5607 (MAP2K5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    5607 (MAP2K5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    5607 (MAP2K5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5607 (MAP2K5)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5607 (MAP2K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5607 (MAP2K5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5607 (MAP2K5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   5607 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 5607
NCBI-ProteinID: NP_660143
OMIM: 602520
HGNC: 6845
Ensembl: ENSG00000137764
Vega: OTTHUMG00000133264
Pharos: Q13163(Tchem)
UniProt: Q13163 A0A024R5Y2
Structure
PDB: 

Position
15q23
AA seq 448 aa AA seqDB search
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNAAVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccctttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacagtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatactagccaatggccag
atgaatgaacaagacatacgatatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgcgat
tcatcatatatcattggattttatggagcattttttgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacatgtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagacgtgaagccctccaatatgctagtaaacacaagaggacaggttaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattctgatgtctgg
agcttaggaatctcttttatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccagttggagagttctcggagccatttgtacatttcatcactcagtgtatg
cgaaaacagccaaaagaaaggccagcacctgaagaattgatgggccacccgttcatcgtg
cagttcaatgatggaaatgccgccgtggtgtccatgtgggtgtgccgggcgctggaggag
aggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system