KEGG   Homo sapiens (human): 5610Help
Entry
5610              CDS       T01001                                 

Gene name
EIF2AK2, EIF2AK1, PKR, PPP1R83, PRKR
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04217  Necroptosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00269  HCV Core to host-cell-protein activation
N00273  HCV NS5A to host-cell-protein inhibition
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5610 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5610 (EIF2AK2)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    5610 (EIF2AK2)
  09167 Infectious diseases
   05162 Measles
    5610 (EIF2AK2)
   05164 Influenza A
    5610 (EIF2AK2)
   05160 Hepatitis C
    5610 (EIF2AK2)
   05168 Herpes simplex infection
    5610 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5610 (EIF2AK2)
   05169 Epstein-Barr virus infection
    5610 (EIF2AK2)
   05165 Human papillomavirus infection
    5610 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5610 (EIF2AK2)
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5610 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    5610 (EIF2AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5610 (EIF2AK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   5610 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5610 (EIF2AK2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5610 (EIF2AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr dsrm Kinase-like Kdo DND1_DSRM FTA2
Motif
Other DBs
NCBI-GeneID: 5610
NCBI-ProteinID: NP_001129123
OMIM: 176871
HGNC: 9437
Ensembl: ENSG00000055332
Vega: OTTHUMG00000100962
Pharos: P19525(Tbio)
UniProt: P19525 Q8IW76
Structure
PDB: 

Position
2p22.2
AA seq 551 aa AA seqDB search
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgatctttcagcaggtttcttcatggaggaacttaatacataccgtcagaag
cagggagtagtacttaaatatcaagaactgcctaattcaggacctccacatgataggagg
tttacatttcaagttataatagatggaagagaatttccagaaggtgaaggtagatcaaag
aaggaagcaaaaaatgccgcagccaaattagctgttgagatacttaataaggaaaagaag
gcagttagtcctttattattgacaacaacgaattcttcagaaggattatccatggggaat
tacataggccttatcaatagaattgcccagaagaaaagactaactgtaaattatgaacag
tgtgcatcgggggtgcatgggccagaaggatttcattataaatgcaaaatgggacagaaa
gaatatagtattggtacaggttctactaaacaggaagcaaaacaattggccgctaaactt
gcatatcttcagatattatcagaagaaacctcagtgaaatctgactacctgtcctctggt
tcttttgctactacgtgtgagtcccaaagcaactctttagtgaccagcacactcgcttct
gaatcatcatctgaaggtgacttctcagcagatacatcagagataaattctaacagtgac
agtttaaacagttcttcgttgcttatgaatggtctcagaaataatcaaaggaaggcaaaa
agatctttggcacccagatttgaccttcctgacatgaaagaaacaaagtatactgtggac
aagaggtttggcatggattttaaagaaatagaattaattggctcaggtggatttggccaa
gttttcaaagcaaaacacagaattgacggaaagacttacgttattaaacgtgttaaatat
aataacgagaaggcggagcgtgaagtaaaagcattggcaaaacttgatcatgtaaatatt
gttcactacaatggctgttgggatggatttgattatgatcctgagaccagtgatgattct
cttgagagcagtgattatgatcctgagaacagcaaaaatagttcaaggtcaaagactaag
tgccttttcatccaaatggaattctgtgataaagggaccttggaacaatggattgaaaaa
agaagaggcgagaaactagacaaagttttggctttggaactctttgaacaaataacaaaa
ggggtggattatatacattcaaaaaaattaattcatagagatcttaagccaagtaatata
ttcttagtagatacaaaacaagtaaagattggagactttggacttgtaacatctctgaaa
aatgatggaaagcgaacaaggagtaagggaactttgcgatacatgagcccagaacagatt
tcttcgcaagactatggaaaggaagtggacctctacgctttggggctaattcttgctgaa
cttcttcatgtatgtgacactgcttttgaaacatcaaagtttttcacagacctacgggat
ggcatcatctcagatatatttgataaaaaagaaaaaactcttctacagaaattactctca
aagaaacctgaggatcgacctaacacatctgaaatactaaggaccttgactgtgtggaag
aaaagcccagagaaaaatgaacgacacacatgttag

DBGET integrated database retrieval system