KEGG   Homo sapiens (human): 5611
Entry
5611              CDS       T01001                                 

Gene name
DNAJC3, ACPHD, ERdj6, HP58, P58, P58IPK, PRKRI, p58(IPK)
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C3
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05164  Influenza A
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06170  Influenza A virus (IAV)
  Element
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Disease
H02430  Ataxia, combined cerebellar and peripheral, with hearing loss and diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5611 (DNAJC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5611 (DNAJC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5611 (DNAJC3)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   5611 (DNAJC3)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_19 DnaJ TPR_16 TPR_8 TPR_14 TPR_11 TPR_9 TPR_12 TPR_17 TPR_20 ANAPC3 TPR_21 TPR_6 PRAI TPR_10 Ndufs5
Other DBs
NCBI-GeneID: 5611
NCBI-ProteinID: NP_006251
OMIM: 601184
HGNC: 9439
Ensembl: ENSG00000102580
Vega: OTTHUMG00000017227
Pharos: Q13217(Tbio)
UniProt: Q13217 A8KA82
Structure
PDB: 
2Y4T 2Y4U

Position
13q32.1
AA seq 504 aa
MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPS
IAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHR
SWNSWQGFNPFSSGGPFRFKFHFN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggtggcccccggctccgtgaccagccggctgggctcggtattccccttcctgctagtc
ctggtggatctgcagtacgaaggtgctgaatgtggagtaaatgcagatgttgagaaacat
cttgaattgggcaagaaattacttgcagctggacagctagctgatgctttatctcagttt
catgctgccgtagatggtgaccctgataactatattgcttattatcggagggctactgtc
tttttagctatgggcaaatcaaaagctgcacttcctgatttaactaaagtgattcaattg
aagatggacttcactgcagcaagattacagagaggtcacttattactcaaacaaggaaaa
cttgatgaagcagaagatgattttaaaaaagtgctcaaatctaatccaagtgaaaatgaa
gaaaaggaagcacagtctcaacttataaaatctgatgaaatgcagcgtttgcgttcacaa
gcacttaacgcttttggaagtggagattatactgctgctatagccttccttgataagatt
ttagaggtttgtgtttgggatgcagaactacgggaacttcgagctgaatgttttataaaa
gaaggagaacctaggaaagctataagtgacttaaaagctgcgtcaaagttgaagaatgat
aatactgaagcgttttataaaataagcacactgtactaccaactaggagaccacgaactg
tccctcagtgaagttcgggaatgtcttaaacttgaccaggatcataaaaggtgttttgca
cactataaacaagtaaagaaacttaataagctgattgagtcagctgaagagctcatcaga
gatggcagatacacagatgctaccagcaaatatgaatctgtcatgaaaacagagccaagc
attgctgaatatacagttcgttcaaaggagaggatttgccactgcttttctaaggacgag
aagcctgttgaagctattagggtttgttctgaagttttacagatggaacctgacaatgtg
aatgccctgaaagatcgagcagaggcctatttgatagaggaaatgtatgatgaagctatt
caggattatgaaactgctcaggaacacaatgaaaatgatcagcagattcgagaaggtcta
gagaaagcacaaagattattgaaacagtcgcagaaacgagattattataaaatcttggga
gtaaaaagaaatgccaaaaagcaagaaattattaaagcataccgaaaattagcactgcag
tggcacccagataacttccagaatgaagaagaaaagaaaaaagctgagaaaaagttcatt
gatatagcagctgctaaagaagtcctctctgatccagaaatgagaaagaagtttgacgac
ggagaagatcctttggatgcagagagccagcaaggaggcggcggcaaccctttccacaga
agctggaactcatggcaagggttcaatcccttcagctcaggcggaccatttagatttaaa
ttccacttcaattaa

DBGET integrated database retrieval system