KEGG   Homo sapiens (human): 56159Help
Entry
56159             CDS       T01001                                 

Gene name
TEX11, MZIP4, SPGFX2, Spo22, TGC1, TSGA3, ZIP4
Definition
(RefSeq) testis expressed 11
Organism
hsa  Homo sapiens (human)
Disease
H01282  Spermatogenic failure
SSDB OrthologParalogGFIT
Motif
Pfam: SPO22 TPR_19 TPR_2 TPR_9 G2BR
Motif
Other DBs
NCBI-GeneID: 56159
NCBI-ProteinID: NP_001003811
OMIM: 300311
HGNC: 11733
Ensembl: ENSG00000120498
Vega: OTTHUMG00000021782
Pharos: Q8IYF3(Tbio)
UniProt: Q8IYF3
Position
Xq13.1
AA seq 940 aa AA seqDB search
MISAHCNLRLLCSSDSSASASQVAGTTEVVENLVTNDNSPNIPEAIDRLFSDIANINRES
MAEITDIQIEEMAVNLWNWALTIGGGWLVNEEQKIRLHYVACKLLSMCEASFASEQSIQR
LIMMNMRIGKEWLDAGNFLIADECFQAAVASLEQLYVKLIQRSSPEADLTMEKITVESDH
FRVLSYQAESAVAQGDFQRASMCVLQCKDMLMRLPQMTSSLHHLCYNFGVETQKNNKYEE
SSFWLSQSYDIGKMDKKSTGPEMLAKVLRLLATNYLDWDDTKYYDKALNAVNLANKEHLS
SPGLFLKMKILLKGETSNEELLEAVMEILHLDMPLDFCLNIAKLLMDHERESVGFHFLTI
IHERFKSSENIGKVLILHTDMLLQRKEELLAKEKIEEIFLAHQTGRQLTAESMNWLHNIL
WRQAASSFEVQNYTDALQWYYYSLRFYSTDEMDLDFTKLQRNMACCYLNLQQLDKAKEAV
AEAERHDPRNVFTQFYIFKIAVIEGNSERALQAIITLENILTDEESEDNDLVAERGSPTM
LLSLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAEMPESEDKK
KEMDRLLTCLNRAFVKLSQPFGEEALSLESRANEAQWFRKTAWNLAVQCDKDPVMMREFF
ILSYKMSQFCPSDQVILIARKTCLLMAVAVDLEQGRKASTAFEQTMFLSRALEEIQTCND
IHNFLKQTGTFSNDSCEKLLLLYEFEVRAKLNDPLLESFLESVWELPHLETKTFETIAII
AMEKPAHYPLIALKALKKALLLYKKEEPIDISQYSKCMHNLVNLSVPDGASNVELCPLEE
VWGYFEDALSHISRTKDYPEMEILWLMVKSWNTGVLMFSRSKYASAEKWCGLALRFLNHL
TSFKESYETQMNMLYSQLVEALSNNKGPVFHEHGYWSKSD
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgatctcggctcactgcaacctccgcctcctgtgttcaagcgattcttctgcctcagcc
tcccaagtagctgggactacagaagttgttgaaaacctggttacaaatgataattcacct
aacataccagaggcaattgatagactcttcagcgacatagcaaatatcaacagggagtct
atggctgaaataacagacattcagattgaagaaatggcagtaaacctatggaactgggca
cttaccataggaggaggttggcttgtaaatgaagagcagaaaattagattacattatgtt
gcttgcaagttgctgagtatgtgtgaagcctcatttgcctcagaacaaagtattcaacga
ctgattatgatgaatatgagaataggaaaagaatggttggatgctggaaattttctaatc
gctgatgaatgttttcaagctgctgtggccagtctggagcaattatacgtcaaattaatt
caaaggagctcccctgaggctgacttgaccatggagaagattactgttgagagtgaccac
ttcagagtgctttcttaccaagcagagtcagcagttgctcaaggggattttcaaagagca
tctatgtgtgtactgcaatgtaaagatatgttgatgaggctcccccagatgacttcaagt
cttcatcatctctgttacaactttggagtagaaacccagaagaataataaatatgaagaa
agttctttctggcttagccaaagctatgatattgggaagatggataagaaatctactggg
ccagaaatgctggctaaagttctacggctattagccacgaattatttggattgggatgac
accaaatattatgataaggctctcaatgctgtaaacctagcaaacaaggaacatttaagt
tctcctgggcttttcttaaaaatgaaaatcctcttgaaaggcgaaacatctaatgaagaa
ctccttgaagctgtcatggaaatactacatcttgacatgcccttagacttctgtctgaac
attgctaaactgctgatggatcatgaaagagaatctgttgggtttcatttcctgacgatt
attcatgaacgttttaagtcatcggaaaatattggaaaagttctgatactccatactgac
atgcttttacaaaggaaggaagaacttcttgccaaggagaagattgaagaaatcttttta
gctcaccaaacaggaagacaactgacagcagaatcaatgaactggttacacaacattctg
tggagacaagctgccagtagttttgaggtacaaaattacactgatgccctacaatggtac
tattattctctgaggttttattcaactgatgaaatggatctggacttcaccaagctgcag
aggaacatggcttgctgttacctgaatttgcaacaacttgataaggccaaagaggcagtg
gcagaagctgaacgacatgaccctaggaacgttttcactcaattttatatattcaagatt
gcagtcatagagggcaactctgaaagagctttgcaggcaataattactttagagaatata
ttaacagatgaagagtcagaagataatgatctagttgcagagagaggttcacctaccatg
cttctaagtttagctgcccagtttgctctagagaatggacaacaaattgtggcagaaaaa
gctttggaatatttagctcaacattcagaagaccaggaacaagttcttacagctgtaaag
tgtttgcttcgttttcttcttccaaaaattgctgaaatgccggaatctgaagataagaag
aaagaaatggatcgacttttgacttgcctgaatagagcctttgtgaaactttctcagcct
tttggtgaagaagccttaagtttggagtcaagagctaatgaagctcagtggtttcgaaaa
acagcttggaacttggctgtgcaatgtgacaaagatccagtgatgatgagagagtttttt
atactttcttataagatgtcccagttttgtccttctgatcaagtaattctgattgcacgg
aaaacatgtttacttatggcagttgcagttgatctagagcaagggagaaaagcttcaaca
gcttttgaacagaccatgttcctgagtcgtgcacttgaggagatccagacatgcaatgac
atccataatttcctgaaacaaacagggaccttctcaaatgattcatgtgagaaattgctt
ctgctgtacgagtttgaagttagagccaaattgaatgatccattactggaaagcttcctg
gaatcagtgtgggagttgcctcatttagaaactaaaacttttgaaacaattgcaataata
gcaatggaaaagcctgcacactatcctttgattgctctcaaggccttgaaaaaggcttta
ttgctctacaaaaaggaagaaccaattgatatatcacaatacagcaaatgtatgcacaac
ttggttaacctctcagtgccagatggggcgtcgaatgtagagctctgtcccctggaagaa
gtttggggctattttgaagatgctctgagccacattagccgcactaaagactacccagaa
atggagattctctggctgatggtcaagtcctggaataccggagtacttatgtttagcagg
agcaagtatgcatctgctgaaaagtggtgtggcctggccttgcgtttccttaaccacctt
acctccttcaaggaaagctatgaaactcagatgaatatgctgtatagtcagcttgtggaa
gcattgagtaacaacaagggcccagtttttcatgaacatggctactggagcaagtcagat
tag

DBGET integrated database retrieval system