KEGG   Homo sapiens (human): 56165
Entry
56165             CDS       T01001                                 

Gene name
TDRD1, CT41.1
Definition
(RefSeq) tudor domain containing 1
  KO
K18405  tudor domain-containing protein 1/4/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    56165 (TDRD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    56165 (TDRD1)
SSDB
Motif
Pfam: TUDOR SMN zf-MYND DUF4537
Other DBs
NCBI-GeneID: 56165
NCBI-ProteinID: NP_942090
OMIM: 605796
HGNC: 11712
Ensembl: ENSG00000095627
Vega: OTTHUMG00000019083
Pharos: Q9BXT4(Tbio)
UniProt: Q9BXT4 A0A140VJW6
Structure
PDB: 
5M9N

Position
10q25.3
AA seq 1189 aa
MSVKSPFNVMSRNNLEAPPCKMTEPFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSEN
GNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESN
SPPKEVNIKPGNNVRPAKSKKLNKLVENSLSISNPGLFTSLGPPLRSTTCHRCGLFGSLR
CSQCKQTYYCSTACQRRDWSAHSIVCRPVQPNFHKLENKSSIETKDVEVNNKSDCPLGVT
KEIAIWAERIMFSDLRSLQLKKTMEIKGTVTEFKHPGDFYVQLYSSEVLEYMNQLSASLK
ETYANVHEKDYIPVKGEVCIAKYTVDQTWNRAIIQNVDVQQKKAHVLYIDYGNEEIIPLN
RIYHLNRNIDLFPPCAIKCFVANVIPAEGNWSSDCIKATKPLLMEQYCSIKIVDILEEEV
VTFAVEVELPNSGKLLDHVLIEMGYGLKPSGQDSKKENADQSDPEDVGKMTTENNIVVDK
SDLIPKVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGRKLAELQASLSKYCDQLPPRSDF
YPAIGDICCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLMRLCPIIPKLLEL
PMQAIKCVLAGVKPSLGIWTPEAICLMKKLVQNKIITVKVVDKLENSSLVELIDKSETPH
VSVSKVLLDAGFAVGEQSMVTDKPSDVKETSVPLGVEGKVNPLEWTWVELGVDQTVDVVV
CVIYSPGEFYCHVLKEDALKKLNDLNKSLAEHCQQKLPNGFKAEIGQPCCAFFAGDGSWY
RALVKEILPNGHVKVHFVDYGNIEEVTADELRMISSTFLNLPFQGIRCQLADIQSRNKHW
SEEAITRFQMCVAGIKLQARVVEVTENGIGVELTDLSTCYPRIISDVLIDEHLVLKSASP
HKDLPNDRLVNKHELQVHVQGLQATSSAEQWKTIELPVDKTIQANVLEIISPNLFYALPK
GMPENQEKLCMLTAELLEYCNAPKSRPPYRPRIGDACCAKYTSDDFWYRAVVLGTSDTDV
EVLYADYGNIETLPLCRVQPITSSHLALPFQIIRCSLEGLMELNGSSSQLIIMLLKNFML
NQNVMLSVKGITKNVHTVSVEKCSENGTVDVADKLVTFGLAKNITPQRQSALNTEKMYRM
NCCCTELQKQVEKHEHILLFLLNNSTNQNKFIEMKKLLKKTASLGGKPL
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgagtgttaaatcgccatttaatgtgatgtcaagaaataatttggaagcacctccttgt
aagatgacagagccatttaattttgagaaaaatgaaaacaagcttccaccacatgagtct
ttaagaagtcctggaacacttcctaaccaccctaatttcaggctgaaaagctcagagaat
ggaaataaaaagaacaattttttgctttgtgagcaaaccaaacaatatttggctagtcag
gaagacaattcagtttcttcaaacccgaatggcatcaacggagaagtagttggctccaaa
ggagacaggaaaaaattgccagcaggaaactcagtgtcaccaccaagtgctgaaagtaat
tcaccacccaaagaagtgaatattaagcctggaaataatgtacgtcctgcaaaatcaaaa
aaactaaacaagttggtcgagaattccttgtccataagtaatccagggctcttcacctcc
ttaggacctcctcttcggtccacaacttgccatcgctgtggcctatttggatcgctgagg
tgctctcagtgcaagcagacctactattgctccacagcatgtcaaagaagagactggtct
gcacacagcatcgtgtgcaggcctgttcagccaaatttccacaaacttgaaaataaatca
tctattgaaacaaaggatgtggaggtaaacaataagagtgactgtccacttggagttact
aaggaaatagccatttgggctgagagaataatgttttctgatttgagaagtctacaactc
aagaaaaccatggaaataaagggtacggttaccgaattcaaacacccaggggacttctac
gtgcagttatattcttcagaagttttagaatacatgaaccaactctctgccagcttaaaa
gaaacatatgcaaatgtgcatgaaaaagactatattcctgttaagggggaagtttgtatt
gccaagtacactgttgatcagacctggaacagagcaatcatacaaaacgttgatgtgcag
caaaagaaggcacatgtcttatatattgattatggaaatgaagaaataattccattaaac
agaatttaccacctcaacaggaacattgacttgtttcctccttgtgccataaagtgcttt
gtagccaatgttatcccagcagaagggaattggagcagtgattgtatcaaagctactaaa
ccactgttaatggagcagtactgctccataaagattgtcgacatcttggaagaggaagtg
gttacctttgctgtagaagttgagctgccaaattcaggaaaacttttagaccatgtgctt
atagaaatgggatatggcttgaaacccagtggacaagattctaagaaggaaaatgcagat
caaagtgatcctgaagatgttggaaaaatgacaactgaaaacaacattgtcgtagacaaa
agtgacctaatcccaaaagtgttaactttgaatgtaggtgatgagttttgtggtgtggtt
gcccacattcaaacaccagaagacttcttttgtcaacaactgcaaagtggccgaaagctt
gctgaacttcaggcatcccttagcaagtactgtgatcagttgcctccacgctctgatttt
tatccagccattggtgatatatgttgtgctcagttctcagaggatgatcagtggtaccgt
gcctctgttttggcttacgcttctgaagaatctgtactggtcggatatgtagattatgga
aactttgaaatccttagtttgatgagactttgtcccataatcccaaagttgttggaattg
ccaatgcaagctataaagtgtgtactagcaggagtaaagccatcattaggaatttggact
ccagaagctatttgtctcatgaaaaaacttgtacagaacaaaataatcacagtgaaagtg
gtggacaagttggaaaacagttccctggtggagcttattgataaatccgagacgcctcat
gtcagtgttagcaaagttctcctagatgcaggctttgctgtgggagaacagagtatggtg
acagataaacccagtgacgtgaaagaaaccagtgttcccttgggtgtggaaggaaaagta
aatccattggagtggacatgggttgaacttggtgttgaccaaacagtagatgttgtggtc
tgtgtgatatatagtcctggagaattttattgccatgtgcttaaagaggatgctttaaag
aaactcaatgatttgaacaagtcattagcagaacactgccagcagaagttacctaatggt
ttcaaggcagagataggacaaccttgttgtgctttttttgcaggtgatggtagttggtat
cgtgctttagtcaaggaaatcttaccaaatggacatgttaaagtacattttgtggattat
ggaaacatcgaagaagttactgcagatgaactccgaatgatatcatcaacatttttaaac
cttccctttcagggaatacggtgccagttagcagatatacagtctagaaacaaacattgg
tctgaagaagccataacaagattccagatgtgtgttgctgggataaaattgcaagccaga
gtggttgaagtcactgaaaatgggataggagttgaactcaccgatctctccacttgttat
cccagaataattagtgatgttctgattgatgaacatctggttttaaaatctgcttcacca
cataaagacttaccaaatgacagacttgttaataaacatgagcttcaagttcatgtacag
ggacttcaagctacctcttcagctgagcaatggaagacgatagaattgccagtggataaa
actatacaagcaaatgtattagaaatcataagcccaaacttgttttatgctctaccaaaa
gggatgccagaaaatcaggaaaagctgtgcatgttgacagctgaattattagaatactgc
aatgctccgaaaagtcgaccaccctatagaccaagaattggagacgcatgctgtgccaaa
tacacaagtgatgatttttggtatcgtgcagttgttctggggacatcagacactgatgtg
gaagtgctctatgcagactatggaaacattgaaaccctgcctctttgcagagtgcaacca
atcacctctagccacctggcgcttcctttccaaattattagatgttcacttgaaggatta
atggaattgaatggaagctcttctcaattaataataatgctattaaaaaatttcatgttg
aatcagaatgtaatgctttctgtgaaaggaattacaaagaatgtccatacagtgtcagtt
gagaaatgttctgagaatgggactgtcgatgtagctgataagctagtgacatttggtctg
gcaaaaaacatcacacctcaaaggcagagtgctttaaatacagaaaagatgtataggatg
aattgctgctgcacagagttacagaaacaagttgaaaaacatgaacatattcttctcttc
ctcttaaacaattcaaccaatcaaaataaatttattgaaatgaaaaaactgttaaaaaaa
acagcatctcttggaggtaaacccttatga

DBGET integrated database retrieval system