KEGG   Homo sapiens (human): 5617Help
Entry
5617              CDS       T01001                                 

Gene name
PRL, GHA1
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Drug target
Bromocriptine (DG00452): D00780 D03165
Cabergoline: D00987
Terguride: D01348
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    5617 (PRL)
   04151 PI3K-Akt signaling pathway
    5617 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5617 (PRL)
   04060 Cytokine-cytokine receptor interaction
    5617 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    5617 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5617 (PRL)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   5617 (PRL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1
Motif
Other DBs
NCBI-GeneID: 5617
NCBI-ProteinID: NP_000939
OMIM: 176760
HGNC: 9445
Ensembl: ENSG00000172179
Vega: OTTHUMG00000016111
Pharos: P01236(Tbio)
CPD: C18201
UniProt: P01236 Q5THQ0
Structure
PDB: 

Position
6p22.3
AA seq 227 aa AA seqDB search
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtgtcaaacctg
ctcctgtgccagagcgtggcccccttgcccatctgtcccggcggggctgcccgatgccag
gtgacccttcgagacctgtttgaccgcgccgtcgtcctgtcccactacatccataacctc
tcctcagaaatgttcagcgaattcgataaacggtatacccatggccgggggttcattacc
aaggccatcaacagctgccacacttcttcccttgccacccccgaagacaaggagcaagcc
caacagatgaatcaaaaagactttctgagcctgatagtcagcatattgcgatcctggaat
gagcctctgtatcatctggtcacggaagtacgtggtatgcaagaagccccggaggctatc
ctatccaaagctgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg
atagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggtcggga
cttccatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctgctc
cactgcctacgcagggattcacataaaatcgacaattatctcaagctcctgaagtgccga
atcatccacaacaacaactgctaa

DBGET integrated database retrieval system