KEGG   Homo sapiens (human): 5618Help
Entry
5618              CDS       T01001                                 

Gene name
PRLR, HPRL, MFAB, RI-PRLR, hPRLrI
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Disease
H01388  Hyperprolactinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5618 (PRLR)
   04151 PI3K-Akt signaling pathway
    5618 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5618 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    5618 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    5618 (PRLR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   5618 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 5618
NCBI-ProteinID: NP_000940
OMIM: 176761
HGNC: 9446
Ensembl: ENSG00000113494
Vega: OTTHUMG00000090789
Pharos: P16471(Tbio)
UniProt: P16471
Structure
PDB: 

Position
5p13.2
AA seq 622 aa AA seqDB search
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaaccgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcactgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactttatgtggac
gtgacttacatagttcagccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctgattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgctggtggatccaaatgttcaacatggcccttaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccactctgttgaatgaagcaggtaaagatgctttaaaa
tcctctcaaaccattaagtctagagaagagggaaaggcaacccagcagagggaggtagaa
agcttccattctgagactgaccaggatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggtgca
ttatcattgctaccaaaacagagagagaacagcggcaagcccaagaagcccgggactcct
gagaacaataaggagtatgccaaggtgtccggggtcatggataacaacatcctggtgttg
gtgccagatccacatgctaaaaacgtggcttgctttgaagaatcagccaaagaggcccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttcactgcaacatcaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcactga

DBGET integrated database retrieval system