KEGG   Homo sapiens (human): 56204Help
Entry
56204             CDS       T01001                                 

Gene name
FAM214A, KIAA1370
Definition
(RefSeq) family with sequence similarity 214 member A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Chromosome_seg DUF4210
Motif
Other DBs
NCBI-GeneID: 56204
NCBI-ProteinID: NP_062546
HGNC: 25609
Ensembl: ENSG00000047346
Vega: OTTHUMG00000172688
Pharos: Q32MH5(Tdark)
UniProt: Q32MH5
Position
15q21.2-q21.3
AA seq 1076 aa AA seqDB search
MKPDRDTLDEYFEYDAEEFLVSLALLITEGRTPECSVKGRTESFHCPPAQSCYPVTTKHE
CSDKLAQCRQARRTRSEVTLLWKNNLPIMVEMMLLPDCCYSDDGPTTEGIDLNDPAIKQD
ALLLERWILEPVPRQNGDRFIEEKTLLLAVRSFVFFSQLSAWLSVSHGAIPRNILYRISA
ADVDLQWNFSQTPIEHVFPVPNVSHNVALKVSVQSLPRQSNYPVLTCSIHTNIGLYEKRI
QQHKLKTHQHHNPNEAEQCGTNSSQRLCSKQTWTMAPESVLHAKSGPSPEYTAAVKNIKL
YPGTGSKSDHGTSQANILGFSGIGDIKSQETSVRTLKSFSMVDSSISNRQSFWQSAGETN
PLIGSLIQERQEIIARIAQHLIHCDPSTSHVSGRPFNTQESSSLHSKLFRVSQENENVGK
GKEAFSMTFGSPEFSSPEDTNEGKIRLKPETPRSETCISNDFYSHMPVGETNPLIGSLLQ
ERQDVIARIAQHLEHIDPTASHIPRQSFNMHDSSSVASKVFRSSYEDKNLLKKNKDESSV
SISHTKCSLLGDISDGKNLVPNKCFTSFKNNSKEKCSLKHQTRNQCQNNPSEIIQSTYQE
TQNKSSSLSTSSILSQHKENNLDLTSRFKEQEMSNGIDKQYSNCTTIDKQICTNKYKEKI
INENYNPKFFGNLQSDDSKKNDSKIKVTVLEMSEYLNKYESMSSNKDSKRPKTCEQNTQL
NSIENYLNKDNEGFKCKKSDQLKNEQDKQEDPTNEKSQNYSQRRSIKDCLSTCEQPKNTE
VLRTTLKHSNVWRKHNFHSLDGTSTRAFHPQTGLPLLSSPVPQRKTQSGCFDLDSSLLHL
KSFSSRSPRPCLNIEDDPDIHEKPFLSSSAPPITSLSLLGNFEESVLNYRFDPLGIVDGF
TAEVGASGAFCPTHLTLPVEVSFYSVSDDNAPSPYMGVITLESLGKRGYRVPPSGTIQVT
LFNPNKTVVKMFVVIYDLRDMPANHQTFLRQRTFSVPVKQEVKRSVNKENIRHTEERLLR
YLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKSYTESPTNPQFSPRC
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagaccgagatactctggatgaatattttgaatatgatgcagaggagttcttg
gtctctttggccttgctgataacagaaggacgaacacctgaatgttctgtaaaaggtcga
acagaaagctttcattgccctccagcacagtcttgttacccagtaactaccaaacatgaa
tgtagtgacaagctggcccagtgccgccaagccagacgaactaggtctgaggtcacattg
ttgtggaagaataaccttccaatcatggtggaaatgatgctactaccagactgctgctac
agcgatgatgggcccaccacagagggaattgatctaaatgatcctgcgattaagcaagat
gcattattattagaaagatggatcttggagccagttcctcgacagaatggtgaccgattt
attgaagagaagacgcttctgttggctgtccgctcatttgtgtttttttctcagttaagt
gcatggctgagtgtttctcatggtgctattccacgaaatattctctacagaatcagtgct
gctgatgtagacctacagtggaatttttcacagactccaattgagcatgtgtttcctgtt
cccaatgtttctcacaatgttgccttgaaagtcagtgttcagtccttgcccagacaatct
aattatccagttttgacgtgcagtattcacactaatattggcctttatgagaaaagaatt
caacaacataaacttaaaactcatcagcaccataacccaaatgaagcagaacaatgtggt
acaaacagttcacagcgtctgtgtagcaaacaaacttggaccatggcacctgaaagtgtg
ttacatgcaaaaagtggcccaagtccagaatatactgcagctgtcaaaaatatcaaacta
tatccaggcactggcagtaaatctgaccatgggacatctcaagccaatattctaggcttt
agtggtataggtgatataaaatcacaagaaacatcagtgagaactttaaaatcattttca
atggttgattccagtatctctaaccgccagagtttctggcagtcagctggtgagactaac
cctttaataggctctttaattcaggagcggcaagaaatcattgcaagaattgcccaacat
ttgattcattgtgatccaagcacttcacatgtttctggacgtccatttaatactcaagag
tctagttcactccattcaaaacttttccgggtttcacaagaaaatgagaacgtgggaaaa
ggtaaagaagctttctccatgacttttggtagtccagagtttagttccccagaagacacc
aatgaggggaaaattcgactaaaaccagaaactcctcgaagtgaaacttgtatttctaat
gacttttattctcatatgcctgttggagagactaatcctttgataggctctttactccag
gagcggcaagatgttattgcaaggattgctcaacacttggagcacattgatccaacagca
tcacatatcccccggcagtcattcaacatgcatgactccagttcggttgcatctaaagtg
tttaggagttcatatgaagacaaaaatttgttgaagaaaaataaggatgagtcctcagtt
tccatttctcacacaaaatgttccttgttaggagacatcagtgatgggaaaaacttagta
cctaataaatgttttacttcttttaaaaataatagtaaagaaaagtgttctttgaaacat
caaacaagaaatcagtgtcagaacaatcctagtgaaatcatccaaagtacgtatcaggag
acacagaacaaaagttctagtttatcaacttcctcaattttgtctcagcacaaagaaaat
aacttagatttgacaagcagattcaaggagcaagaaatgagcaatggaattgataaacag
tattcaaattgcaccactattgacaaacagatttgtacaaataagtataaggaaaaaata
ataaatgagaactataatccaaaattctttggcaatcttcagtctgatgattccaaaaaa
aatgactcaaaaataaaagttactgtgttggaaatgtctgaatatttgaacaaatatgaa
agcatgtcctcaaataaagactcaaaaaggcctaagacatgtgagcaaaatactcaactt
aatagcatagagaattatctcaataaagataatgaaggtttcaaatgtaaaaagtcagac
caattaaaaaatgaacaagataagcaagaagatccaactaatgaaaaatcccaaaactat
tctcagagaagaagtataaaagactgtttgtctacatgtgagcaaccaaaaaatacagag
gtattgaggactacactgaaacattcaaatgtgtggcgaaaacataattttcattccttg
gatggaacttcaaccagagcctttcatcctcaaactggattgcctcttctttcaagccct
gttcctcaaagaaaaacacaatcaggttgctttgatctggattcttcattactacatctg
aaaagcttctcatctagaagtcctcgaccatgtttaaacattgaagatgatccagatatt
catgaaaaaccatttttgagttctagtgctccacctataacaagtcttagtctcctagga
aattttgaggaatctgtcttgaactatcgtttcgatcctctcggcattgttgatggtttt
actgccgaggtaggggcaagtggtgctttctgccccacacatttgactcttccagttgaa
gtgtcattctacagtgtttcagatgacaatgctccctctccttatatgggtgtgattact
ttagagtcccttggtaaaaggggttatcgagtacctccttcaggaacaatacaagtgacc
ttatttaatcctaataagactgtggtgaagatgtttgttgtgatatatgatttacgagat
atgccagccaatcatcagacattcctacgacaaagaactttttctgtacctgttaaacaa
gaagtgaagagaagtgttaataaagagaacatccgacacacagaagaacggttattacgc
tacctcatacatctgaggttccagagttctaaatctggaaagatctacctccatagagac
gtacggctcctgttctctagaaagtcaatggaggttgatagcggtgctgcatatgaactc
aaatcttacactgaatcaccaacaaaccctcagttttcaccaagatgttga

DBGET integrated database retrieval system