KEGG   Homo sapiens (human): 56243Help
Entry
56243             CDS       T01001                                 

Gene name
ETL4, SKT
Definition
(RefSeq) KIAA1217
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: AIP3
Motif
Other DBs
NCBI-GeneID: 56243
NCBI-ProteinID: NP_062536
OMIM: 617367
HGNC: 25428
Ensembl: ENSG00000120549
Vega: OTTHUMG00000017824
UniProt: Q5T5P2
Position
10p12.2-p12.1
AA seq 1943 aa AA seqDB search
MEENESQKCEPCLPYSADRRQMQEQGKGNLHVTSPEDAECRRTKERLSNGNSRGSVSKSS
RNIPRRHTLGGPRSSKEILGMQTSEMDRKREAFLEHLKQKYPHHASAIMGHQERLRDQTR
SPKLSHSPQPPSLGDPVEHLSETSADSLEAMSEGDAPTPFSRGSRTRASLPVVRSTNQTK
ERSLGVLYLQYGDETKQLRMPNEITSADTIRALFVSAFPQQLTMKMLESPSVAIYIKDES
RNVYYELNDVRNIQDRSLLKVYNKDPAHAFNHTPKTMNGDMRMQRELVYARGDGPGAPRP
GSTAHPPHAIPNSPPSTPVPHSMPPSPSRIPYGGTRSMVVPGNATIPRDRISSLPVSRPI
SPSPSAILERRDVKPDEDMSGKNIAMYRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDH
IIAYHRTAIRSASAYCNPSMQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVSD
LRMIDMHAHYNAHGPPHTMQPDRASPSRQAFKKEPGTLVYIEKPRSAAGLSSLVDLGPPL
MEKQVFAYSTATIPKDRETRERMQAMEKQIASLTGLVQSALFKGPITSYSKDASSEKMMK
TTANRNHTDSAGTPHVSGGKMLSALESTVPPSQPPPVGTSAIHMSLLEMRRSVAELRLQL
QQMRQLQLQNQELLRAMMKKAELEISGKVMETMKRLEDPVQRQRVLVEQERQKYLHEEEK
IVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMR
AILRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAM
EKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQHS
VALLNPAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKN
RAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAP
VDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENIT
AKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAF
QKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQM
EFQKVTTGAVRPSDPPKWERGMENSISDASRTSEYKTEIIMKENSISNMSLLRDSRNYSQ
ETVPKASFGFSGISPLEDEINKGSKISGLQYSIPDTENQTLNYGKTKEMEKQNTDKCHVS
SHTRLTESSVHDFKTEDQEVITTDFGQVVLRPKEARHANVNPNEDGESSSSSPTEENAAT
DNIAFMITETTVQVLSSGEVHDIVSQKGEDIQTVNIDARKEMTPRQEGTDNEDPVVCLDK
KPVIIIFDEPMDIRSAYKRLSTIFEECDEELERMMMEEKIEEEEEEENGDSVVQNNNTSQ
MSHKKVAPGNLRTGQQVETKSQPHSLATETRNPGGQEMNRTELNKFSHVDSPNSECKGED
ATDDQFESPKKKFKFKFPKKQLAALTQAIRTGTKTGKKTLQVVVYEEEEEDGTLKQHKEA
KRFEIARSQPEDTPENTVRRQEQPSIESTSPISRTDEIRKNTYRTLDSLEQTIKQLENTI
SEMSPKALVDTSCSSNRDSVASSSHIAQEASPRPLLVPDEGPTALEPPTSIPSASRKGSS
GAPQTSRMPVPMSAKNRPGTLDKPGKQSKLQDPRQYRQANGSAKKSGGDFKPTSPSLPAS
KIPALSPSSGKSSSLPSSSGDSSNLPNPPATKPSIASNPLSPQTGPPAHSASLIPSVSNG
SLKFQSLTHTGKGHHLSFSPQSQNGRAPPPLSFSSSPPSPASSVSLNQGAKGTRTIHTPS
LTSYKAQNGSSSKATPSTAKETS
NT seq 5832 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaatgaaagccagaaatgtgagccgtgccttccttactcagcagacagaaga
cagatgcaggaacaaggcaaaggcaatctgcatgtaacatcaccagaagatgcagaatgc
cgcagaaccaaggaacgcctttctaatggaaacagtcgtggttcagtttccaagtcttcc
cgcaatatcccaaggagacacaccctaggggggccccgaagttccaaggaaatactggga
atgcaaacatctgagatggatcggaagagagaagcgttcctagaacatctgaagcagaag
tacccccaccacgcctctgcaatcatgggtcaccaagagaggctgagagaccagacaagg
agccccaaactgtctcacagtcctcaaccacccagtctgggtgacccggtcgagcattta
tcagagacgtccgctgattctttggaagccatgtctgagggggatgctccaacccctttt
tccagaggcagccggactcgtgcgagccttcctgtggtgaggtcaaccaaccagacgaaa
gaaagatctctgggggttctctatctccagtatggagatgaaaccaagcagctcaggatg
ccgaatgaaatcacaagtgcagacacaatccgtgctctcttcgtaagtgcctttccacag
cagctcaccatgaaaatgctggaatcgcccagtgtcgccatttacatcaaagatgaaagc
agaaatgtctattatgaattaaatgatgtaaggaacattcaagacagatcactcctcaaa
gtgtacaacaaggatcctgcacatgcgtttaatcacacaccaaaaactatgaatggagac
atgaggatgcagagagaacttgtttatgcaagaggagatggccctggggcccctcgcccc
ggatctactgctcatccaccccatgcgattccaaattccccaccgtctactccagtgccc
cattccatgcccccctccccgtccagaattccttatgggggcacccgctccatggttgtt
cctggcaatgccaccatccccagggacagaatctccagcctgccagtctccagacccatc
tctccaagcccaagcgccattttagaaagaagagatgtcaagcctgatgaagacatgagt
ggcaaaaacattgcaatgtacagaaatgagggtttctatgctgatccttacctttatcac
gagggacggatgagcatagcctcatcccatggtggacacccactggatgtccccgaccac
atcattgcatatcaccgcaccgccatccggtcagcgagtgcttattgtaacccctcaatg
caagcggaaatgcatatggaacaatcactgtacagacagaaatcaaggaaatatccggat
agccatttgcctacactgggctccaaaacaccccctgcctctcctcacagagtcagtgac
ctgaggatgatagacatgcacgctcactataatgcccacggcccccctcacaccatgcag
ccagaccgggcctctccgagccgccaggcctttaaaaaggagccaggcaccttggtgtat
atagaaaagccacggagcgctgcaggattatccagccttgtagacctcggccctcctcta
atggagaagcaagtttttgcctacagcacggcgacaatacccaaagacagagagaccaga
gagaggatgcaagccatggagaaacagattgccagtttaactggccttgttcagtctgcg
ctttttaaagggcccattacaagttatagcaaagatgcgtctagcgagaaaatgatgaaa
accacagccaacaggaaccacacagatagtgcaggaacgccccatgtgtctggtgggaag
atgctcagtgctctggagtccacggtgcctcccagccagcctccacctgtgggcacctca
gccatccacatgagcctgcttgagatgaggcggagcgtggcggaactcaggctccagctc
cagcagatgcggcagctccagctgcagaaccaggagttgctgagggcaatgatgaagaag
gccgagctggaaatcagtggcaaagtgatggaaacaatgaagagactggaggatcccgtg
cagcgacagcgcgtcctagtggagcaagagagacaaaaatatcttcatgaggaagagaag
atcgtcaagaagttgtgcgagttggaagactttgttgaagacttgaagaaggactccacg
gcagccagccgattggttactctgaaagacgtggaagacggggctttcctcctgcgtcaa
gtgggagaggctgtagctaccctgaaaggagaatttccaaccttacaaaacaagatgcga
gccatcctgcgcatagaagtggaggccgtgcggtttctgaaggaggagccacacaagctg
gacagtctcctgaagcgtgtgcgcagcatgacagacgtcctgaccatgctgcggagacat
gtcactgatgggctcctgaaaggcacggacgcagcccaagccgcacagtacatggctatg
gaaaaggccacagccgcagaagtcctgaagagtcaggaggaggcagcccacacctccggc
cagcccttccacagcacaggtgcccctggcgatgcgaagtcggaagtggtgcctttgtcc
ggcatgatggttcgccacgcgcagagctcccctgtggtcatccagccctcccagcactcc
gtggccctgctgaaccctgctcagaacttgcctcacgtggccagctccccagccgtcccc
caggaagcaacctccactctgcagatgtcgcaggctccgcagtccccacagatacccatg
aatgggtctgccatgcagagcttgttcattgaagaaatccacagtgtgagtgccaagaac
agggcagtgtctatcgagaaagcagaaaagaaatgggaggaaaaaaggcaaaatctggat
cactataatgggaaagagtttgagaagctcctagaagaagctcaggccaatatcatgaag
tcaataccaaatctggagatgccgccagccacaggcccactgccaaggggagatgcccca
gtggacaaggtggaactttcagaagattctccaaattcggaacaggacttggaaaagctg
gggggaaagtcgccccctcctcctccgccacctcctcgtcgaagctacctgccaggatcg
ggactcaccaccacgaggtcaggcgatgtggtctacaccggcagaaaggagaacatcacc
gctaaggcaagcagtgaagatgctggaccaagcccacagaccagagctacaaaatatcca
gcagaggagcctgcttcagcctggaccccatccccaccgcctgtcaccacctcctcctca
aaggatgaggaggaagaagaagaagaaggagacaaaataatggcagaactccaggcattc
cagaagtgttcctttatggatgtaaattcaaacagtcatgctgagccatcccgggctgac
agtcacgttaaagacactaggtcgggcgccacagtgccacccaaggagaagaagaatttg
gaatttttccatgaagatgtacggaaatctgatgttgaatatgaaaatggcccccaaatg
gaattccaaaaggttaccacaggggctgtaagacctagtgaccctcctaagtgggaaaga
ggaatggagaatagtatttctgatgcatcaagaacatcagaatataaaactgagatcata
atgaaggaaaattccatatccaatatgagtttactcagagacagtagaaactattcccag
gaaactgtgcctaaggccagtttcggtttctctggcattagtccattagaagatgaaata
aacaaagggtctaaaatctcaggcctgcaatactctatacctgacaccgagaaccagacg
ctgaattacggaaagacaaaggagatggaaaagcaaaatacggataagtgtcacgtttcc
tctcacactagactaacagaatcaagcgtgcatgattttaaaacagaagatcaagaggtt
atcacgacagattttggccaagttgttctaagacccaaggaggcaaggcatgctaacgtg
aaccctaatgaggatggagaatcaagttcaagttctcccactgaagaaaatgcagccact
gacaatattgccttcatgattaccgaaaccactgtccaggttctttccagtggggaggtg
catgatattgttagccaaaagggagaagacatacagacggttaatatcgatgccagaaaa
gagatgaccccccgacaagaagggactgacaatgaggatccagtcgtgtgcctggacaag
aaaccagtgatcatcattttcgatgagcccatggacatccggtctgcctataagagactt
tcaactatctttgaggaatgtgatgaggaattagagagaatgatgatggaggaaaagata
gaggaggaggaagaggaggaaaatggggattctgtagtccagaataataacacttcccag
atgtctcataagaaggtggccccaggcaatcttagaaccggacaacaggtggaaacaaag
tcacagccacactccctggccacagagaccagaaacccaggaggacaggaaatgaacaga
acggagctgaacaagttcagccacgtggattctccaaattcggaatgcaagggtgaggac
gcgaccgatgaccagtttgaaagccccaagaaaaagtttaaattcaaattccctaagaag
caactcgccgctctcactcaagccattcgcaccggaactaaaacagggaagaagactttg
caagtggtagtctatgaagaagaggaagaggatggcaccctgaaacagcacaaagaagcc
aagcgcttcgaaatcgctaggtctcaacctgaagacacccctgaaaacacagtgaggagg
caagagcagcccagcatcgagagtacatctccgatttcaagaactgatgaaattagaaaa
aacacctacagaacattggatagcctggagcagaccattaaacagctcgaaaatacaatc
agtgaaatgagtcccaaagccctagttgatacctcatgttcttccaacagagattctgtt
gcaagttcatcccacatagcccaagaggcctctccccgacccttgctagttccggatgaa
ggtcccactgccctagagccccctacgtcgataccttcagcttcacgtaagggctccagc
ggggccccacagacgagcaggatgcctgtccccatgagtgccaagaacagacccggaacc
ctggacaaacccggcaagcagtccaaactgcaggatccccgccaatatcgtcaggctaat
ggaagtgctaagaaatctggtggggactttaagcctacttccccctccttacctgcttct
aagattccagccctttctcccagctctgggaaaagcagttctctgccctcttctagtggt
gacagctctaacctccctaatccacctgctactaaaccatcgattgcttctaaccctctc
agcccccaaacaggaccacctgctcactctgcctccctcatcccttctgtctctaatggc
tctttgaagtttcagagcctcactcatacaggtaaaggtcaccatctttcattctcaccg
cagagtcaaaatggccgagcaccccctcctttgtcattttcctcctcccctccttctcct
gcctcctccgtctcactgaatcaaggtgccaagggcaccaggaccatccatactcccagc
ctcaccagctacaaggcacagaatggaagttcaagcaaagccaccccatccacagcaaaa
gaaacctcttaa

DBGET integrated database retrieval system