KEGG   Homo sapiens (human): 56253Help
Entry
56253             CDS       T01001                                 

Gene name
CRTAM, CD355
Definition
(RefSeq) cytotoxic and regulatory T cell molecule
  KO
K16361  cytotoxic and regulatory T-cell molecule
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    56253 (CRTAM)
CD molecules [BR:hsa04090]
 Proteins
  56253 (CRTAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 C2-set_2 ig V-set I-set Ig_2 TMEM154 DUF5305 Adeno_E3_CR1 Izumo-Ig DUF4834 Orf78 MAP17 SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 56253
NCBI-ProteinID: NP_062550
OMIM: 612597
HGNC: 24313
Ensembl: ENSG00000109943
Vega: OTTHUMG00000166026
Pharos: O95727(Tbio)
UniProt: O95727
Structure
PDB: 

Position
11q24.1
AA seq 393 aa AA seqDB search
MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFL
NEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFK
PILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTT
STLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQ
PTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLTLVSFLIFI
LFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQSSHPMRCMNY
ITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagagttctcagcttgctggcatggttccccttgcaagaggcctctctgact
aaccacacagaaaccatcaccgtggaggaaggccagacgctcactctaaagtgtgtcact
tctctgaggaagaactcctccctccagtggctgaccccctcagggttcaccattttttta
aatgagtatcctgctttaaaaaattccaaataccagcttcttcatcactcggccaatcag
ctctccatcactgtgcctaacgtaaccctgcaagatgaaggcgtgtacaagtgcttacat
tacagcgactctgtaagcacaaaggaagtgaaagtgattgtgctggcaactcctttcaag
ccaatcctggaagcttcagttatcagaaagcaaaatggagaagaacatgttgtactcatg
tgctccaccatgagaagcaagccccctccgcagataacctggctacttgggaatagcatg
gaagtgtccggtggaacgctccatgaatttgaaactgatgggaagaaatgtaatactacc
agcactctcataatccacacttatggcaaaaattcaacggtggactgcattatccgacac
agaggcctgcaagggagaaaactagtagcacccttccggtttgaagatttggttactgat
gaagagacagcttcagatgctctggagagaaactctctatcctctcaagacccacagcag
cccaccagtactgtctcagtaacggaagattctagtacatcggagattgacaaggaagag
aaagaacaaaccactcaagatcctgacttgaccaccgaagcaaatcctcagtatttagga
ctggcaagaaagaaaagtggcatcctgctgctcacgctggtgtccttcctcattttcata
ctcttcatcatagtccagctcttcatcatgaagctgaggaaagcacatgtgatatggaag
aaagaaaacgaagtttcagaacacacactagaaagttacagatcaaggtcaaataatgaa
gaaacatcatctgaagagaaaaatggccaatcttcccaccctatgcgttgcatgaactac
atcacaaagttgtactcagaagcaaaaacaaagaggaaggaaaatgtacaacattcaaaa
ttagaagaaaagcacatccaagtaccagagagtattgtgtag

DBGET integrated database retrieval system