KEGG   Homo sapiens (human): 56261Help
Entry
56261             CDS       T01001                                 

Gene name
GPCPD1, EDI3, GDE5, GDPD6, PREI4
Definition
(RefSeq) glycerophosphocholine phosphodiesterase 1
  KO
K18695  glycerophosphocholine phosphodiesterase GPCPD1 [EC:3.1.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    56261 (GPCPD1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    56261 (GPCPD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.2  glycerophosphocholine phosphodiesterase
     56261 (GPCPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDPD CBM_20 PI-PLC-X
Motif
Other DBs
NCBI-GeneID: 56261
NCBI-ProteinID: NP_062539
OMIM: 614124
HGNC: 26957
Ensembl: ENSG00000125772
Vega: OTTHUMG00000031806
Pharos: Q9NPB8(Tdark)
UniProt: Q9NPB8
Structure
PDB: 

Position
20p12.3
AA seq 672 aa AA seqDB search
MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSR
GVSVQYRYFKGYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
TLDSGWLTCQTEIRLRLHYSEKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPLPG
YSCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMN
LFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRS
RTTPIAMSFAQFENLLGINVHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKE
LGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGESDIH
VDANGIDNVENA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacaccttctcaggttgcctttgaaataagaggaactcttttaccaggagaagttttt
gcgatatgtggaagctgtgatgctttgggaaactggaatcctcaaaatgctgtggctctt
cttccagagaatgacacaggtgaaagcatgctatggaaagcaaccattgtactcagtaga
ggagtatcagttcagtatcgctacttcaaagggtactttttagaaccaaagactatcggt
ggtccatgtcaagtgatagttcacaagtgggagactcatctacaaccacgatcaataacc
cctttagaaagcgaaattattattgacgatggacaatttggaatccacaatggtgttgaa
actctggattctggatggctgacatgtcagactgaaataagattacgtttgcattattct
gaaaaacctcctgtgtcaataaccaagaaaaaattaaaaaaatctagatttagggtgaag
ctgacactagaaggcctggaggaagatgacgatgatagggtatctcccactgtactccac
aaaatgtccaatagcttggagatatccttaataagcgacaatgagttcaagtgcaggcat
tcacagccggagtgtggttatggcttgcagcctgatcgttggacagagtacagcatacag
acgatggaaccagataacctggaactaatctttgattttttcgaagaagatctcagtgag
cacgtagttcagggtgatgcccttcctggacatgtgggtacagcttgtctcttatcatcc
accattgctgagagtggaaagagtgctggaattcttactcttcccatcatgagcagaaat
tcccggaaaacaataggcaaagtgagagttgactatataattattaagccattaccagga
tacagttgtgacatgaaatcttcattttccaagtattggaagccaagaataccattggat
gttggccatcgaggtgcaggaaactctacaacaactgcccagctggctaaagttcaagaa
aatactattgcttctttaagaaatgctgctagtcatggtgcagcctttgtagaatttgac
gtacacctttcaaaggactttgtgcccgtggtatatcatgatcttacctgttgtttgact
atgaaaaagaaatttgatgctgatccagttgaattatttgaaattccagtaaaagaatta
acatttgaccaactccagttgttaaagctcactcatgtgactgcactgaaatctaaggat
cggaaagaatctgtggttcaggaggaaaattccttttcagaaaatcagccatttccttct
cttaagatggttttagagtctttgccagaagatgtagggtttaacattgaaataaaatgg
atctgccagcaaagggatggaatgtgggatggtaacttatcaacatattttgacatgaat
ctgtttttggatataattttaaaaactgttttagaaaattctgggaagaggagaatagtg
ttttcttcatttgatgcagatatttgcacaatggttcggcaaaagcagaacaaatatccg
atactatttttaactcaaggaaaatctgagatttatcctgaactcatggacctcagatct
cggacaacccccattgcaatgagctttgcacagtttgaaaatctactggggataaatgta
catactgaagacttgctcagaaacccatcctatattcaagaggcaaaagctaagggacta
gtcatattctgctggggtgatgataccaatgatcctgaaaacagaaggaaattgaaggaa
cttggagttaatggtctaatttatgataggatatatgattggatgcctgaacaaccaaat
atattccaagtggagcaattggaacgcctgaagcaggaattgccagagcttaagagctgt
ttgtgtcccactgttagccgctttgttccctcatctttgtgtggggagtctgatatccat
gtggatgccaacggcattgataacgtggagaatgcttag

DBGET integrated database retrieval system