KEGG   Homo sapiens (human): 56265
Entry
56265             CDS       T01001                                 
Symbol
CPXM1, CPX1, CPXM
Name
(RefSeq) carboxypeptidase X, M14 family member 1
  KO
K08638  carboxypeptidase X1 [EC:3.4.17.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    56265 (CPXM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.-
     56265 (CPXM1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   56265 (CPXM1)
SSDB
Motif
Pfam: Peptidase_M14 F5_F8_type_C CarboxypepD_reg Phage_tube_C CarbopepD_reg_2 Pilosulin
Other DBs
NCBI-GeneID: 56265
NCBI-ProteinID: NP_062555
OMIM: 609555
HGNC: 15771
Ensembl: ENSG00000088882
Pharos: Q96SM3(Tdark)
UniProt: Q96SM3
Position
20:complement(2794074..2800627)
AA seq 734 aa
MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTS
EQHVRIRVIKKKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGL
ESLRVSDSRLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGH
PTRFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVL
NLLPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHH
NYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGEPEVRYVAGMH
GNEALGRELLLLLMQFLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVG
WAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETR
AVIKWMKRIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSN
LAMQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHE
NELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDY
WRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPP
DLRRRLERLRGQKD
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgtgggggctcctgctcgccctggccgccttcgcgccggccgtcggcccggctctgggg
gcgcccaggaactcggtgctgggcctcgcgcagcccgggaccaccaaggtcccaggctcg
accccggccctgcatagcagcccggcacagccgccggcggagacagctaacgggacctca
gaacagcatgtccggattcgagtcatcaagaagaaaaaggtcattatgaagaagcggaag
aagctaactctaactcgccccaccccactggtgactgccgggccccttgtgacccccact
ccagcagggaccctcgaccccgctgagaaacaagaaacaggctgtcctcctttgggtctg
gagtccctgcgagtttcagatagccggcttgaggcatccagcagccagtcctttggtctt
ggaccacaccgaggacggctcaacattcagtcaggcctggaggacggcgatctatatgat
ggagcctggtgtgctgaggagcaggacgccgatccatggtttcaggtggacgctgggcac
cccacccgcttctcgggtgttatcacacagggcaggaactctgtctggaggtatgactgg
gtcacatcatacaaggtccagttcagcaatgacagtcggacctggtggggaagtaggaac
cacagcagtgggatggacgcagtatttcctgccaattcagacccagaaactccagtgctg
aacctcctgccggagccccaggtggcccgcttcattcgcctgctgccccagacctggctc
cagggaggcgcgccttgcctccgggcagagatcctggcctgcccagtctcagaccccaat
gacctattccttgaggcccctgcgtcgggatcctctgaccctctagactttcagcatcac
aattacaaggccatgaggaagctgatgaagcaggtacaagagcaatgccccaacatcacc
cgcatctacagcattgggaagagctaccagggcctgaagctgtatgtgatggaaatgtcg
gacaagcctggggagcatgagctgggggagcctgaggtgcgctacgtggctggcatgcat
gggaacgaggccctggggcgggagttgcttctgctcctgatgcagttcctgtgccatgag
ttcctgcgagggaacccacgggtgacccggctgctctctgagatgcgcattcacctgctg
ccctccatgaaccctgatggctatgagatcgcctaccaccggggttcagagctggtgggc
tgggccgagggccgctggaacaaccagagcatcgatcttaaccataattttgctgacctc
aacacaccactgtgggaagcacaggacgatgggaaggtgccccacatcgtccccaaccat
cacctgccattgcccacttactacaccctgcccaatgccaccgtggctcctgaaacgcgg
gcagtaatcaagtggatgaagcggatcccctttgtgctaagtgccaacctccacgggggt
gagctcgtggtgtcctacccattcgacatgactcgcaccccgtgggctgcccgcgagctc
acgcccacaccagatgatgctgtgtttcgctggctcagcactgtctatgctggcagtaat
ctggccatgcaggacaccagccgccgaccctgccacagccaggacttctccgtgcacggc
aacatcatcaacggggctgactggcacacggtccccgggagcatgaatgacttcagctac
ctacacaccaactgctttgaggtcactgtggagctgtcctgtgacaagttccctcacgag
aatgaattgccccaggagtgggagaacaacaaagacgccctcctcacctacctggagcag
gtgcgcatgggcattgcaggagtggtgagggacaaggacacggagcttgggattgctgac
gctgtcattgccgtggatgggattaaccatgacgtgaccacggcgtggggcggggattat
tggcgtctgctgaccccaggggactacatggtgactgccagtgccgagggctaccattca
gtgacacggaactgtcgggtcacctttgaagagggccccttcccctgcaatttcgtgctc
accaagactcccaaacagaggctgcgcgagctgctggcagctggggccaaggtgcccccg
gaccttcgcaggcgcctggagcggctaaggggacagaaggattga

DBGET integrated database retrieval system